KEGG   Spiribacter sp. UAH-SP71: SPICUR_02250Help
Entry
SPICUR_02250      CDS       T02888                                 

Definition
(GenBank) hypothetical protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
spiu  Spiribacter sp. UAH-SP71
Pathway
spiu00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:spiu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SPICUR_02250
Enzymes [BR:spiu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SPICUR_02250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AGY91464
UniProt: U5T1N7
Position
complement(447743..448669)
Genome map
AA seq 308 aa AA seqDB search
MSTVTVLGLFCADLITRTTRMPAWGETLHGRGFSLMAGGKGSNQAVAAACQGASVTFISR
LGDDAFAPLAQDLYRQVGIDTTYIGIDTAASTGTATILVDDTKGDNAIVIDPGACAGMTE
DDISAAAERIAAADVFVCQLELPLALCRHGIALAQRAGVPVILNPAPACQLPKAFFQSID
YLTPNESEAAELVGHTVETDDQVIRAAKTLRQWGVGNVLMTLGARGVYIDSDGFQGIVPA
ISAGPVADTIGAGDAFNGALAAALADGEDLPAAARRACATAGISVTRSGAAASLPTRGEV
EAQLANPV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgtcacggtactcggccttttctgcgccgatctgatcacccgaaccacccgc
atgcctgcctggggagagaccctccatggccggggtttcagcctgatggccggcggcaaa
ggctcgaatcaggccgtcgccgccgcctgccagggtgcatcggtgacgttcatttcacgc
cttggcgacgatgccttcgcgccgctggcgcaggacctgtacaggcaggtaggcatcgat
accacgtatatcgggatcgatacggcggccagcactggcacggccaccatcctggtggat
gacacaaagggtgataacgccattgtgatcgatcccggcgcatgcgctggaatgaccgag
gacgacatcagcgccgccgccgagcgcatcgccgcggcggacgtcttcgtctgccagctg
gagctgcccctggcactctgcaggcacggcatcgcactggcacaacgcgcgggagtgccc
gtcatcctcaatccggcccccgcctgccagctacccaaggcgtttttccagtcgattgac
tatctgaccccgaatgagtccgaggccgcggaactggtcggccatacggtggagaccgat
gaccaggtgatccgggcggcgaaaacgcttcgtcagtggggcgtgggcaatgtcctgatg
actttgggtgcgcgaggcgtgtatatcgacagcgacggttttcaggggatcgtcccagcg
atcagcgctggaccggtggcggataccattggcgccggcgatgcattcaacggtgctctg
gcagcggccctggctgacggcgaggatctaccggccgcggcgcgccgggcatgtgcgacg
gctgggatctcggtcacccggtcgggcgcggccgcttccctaccgacccgcggcgaggtg
gaggcgcagcttgccaacccggtctga

DBGET integrated database retrieval system