KEGG   Spiribacter sp. UAH-SP71: SPICUR_05910Help
Entry
SPICUR_05910      CDS       T02888                                 

Definition
hypothetical protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
spiu  Spiribacter sp. UAH-SP71
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spiu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPICUR_05910
   00330 Arginine and proline metabolism
    SPICUR_05910
   00340 Histidine metabolism
    SPICUR_05910
   00350 Tyrosine metabolism
    SPICUR_05910
   00360 Phenylalanine metabolism
    SPICUR_05910
   00380 Tryptophan metabolism
    SPICUR_05910
Enzymes [BR:spiu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     SPICUR_05910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1184152..1185231
Genome map
AA seq 359 aa AA seqDB search
MTETSLAIIGAGLAGVTAARVAKAHGVTPLLLEASDRIGGRIDGLRTDDDRLIGDLGPSW
VWPPFQPGVQRWLDRLETPIFDQYEQGDAVLDGFAAQPFRHQLPGQHGMARIVGGPSRLV
EVMAAPLANDAIHYHQSVRSITARTDGRLQIDTEAGAIVTAEQVLVAAPPRLVAERITLP
TGIDHSVVQALAGLPTWMAAQAKAVIRYPTPFWREQGLSGRIASRIGPLFESHDHTSADG
DAALFGFISTPPEHRDPEPLHQAIIDQLTRCLGPQAAQPDAVALRDWALDTAICSTADRH
EPPAHPSVGPSILRSSHLDGRLWFCGAETADQSPGLIEGALLAGENAANAALAQRSNAA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacatcactggcgattatcggtgccggtctggccggcgttactgcggcgcgt
gtcgccaaagcccatggcgtcacgccgttgctcctcgaggccagcgatcggatcggcggg
cgtattgacggacttcgaacggacgatgaccgactgatcggtgatcttgggccctcctgg
gtctggccgcccttccagcctggcgtccagcgctggctggatcggctggagacaccgatc
tttgatcaatacgagcagggagatgcggtactggacggattcgcggcgcagccattccgt
caccaactccccgggcagcacggtatggcacggatcgtcggcggaccaagccgactggtg
gaggtcatggcagcgccgctggccaacgacgctattcattatcatcagagtgttcggtcg
atcacggcacgcacggacggacgcctgcagattgacaccgaggccggtgcgatagtgacg
gccgagcaagtcctggtcgcagcaccgccaaggcttgtcgccgagcggatcacgctgccg
acgggcatcgaccactcagtggttcaggcactggcgggtctgcccacctggatggccgca
caggccaaggcggtcatccgctatccgacaccattctggcgcgagcaagggctctcgggt
cggattgccagtcggatcgggccgctgttcgagtcgcatgaccataccagcgccgatggt
gatgcggcactgttcggcttcatatcaactccgccggagcaccgcgatccagaacccctg
caccaggccatcatcgaccagctcacgcgctgtctcggtccgcaagcggcccagccggac
gccgtggccctgcgggactgggcgctggatacagcgatctgttcaacggccgatcgccat
gagccgcctgcccatccctcagtgggaccatcgatccttcgatcgtcccacctcgacggc
cgtctctggttttgcggggccgagaccgctgatcagagcccaggcctgatcgaaggcgcc
ctgctggccggcgagaacgcggctaacgcggcactcgcgcagcgctcaaacgccgcatga

DBGET integrated database retrieval system