KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0032Help
Entry
MGAS2096_Spy0032  CDS       T00357                                 

Gene name
purK
Definition
phosphoribosylaminoimidazole carboxylase ATPase subunit (EC:4.1.1.21)
Orthology
K01589  
5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:spj00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48784..49893
Genome map
AA seq 369 aa AA seqDB search
MRNKEKSQRSQVVNSFKTIGIIGGGQLGQMMAIAAIYMGHKVITLDPANDCPAARVSEVI
VAPYDDVEALGQLAARCDVLTYEFENVDADGLDAVVSAGQLPQGTDLLRISQNRIVEKDF
LTNKAGVTVAPYKVVTSSLDLEGLDLTKTYVLKTATGGYDGHGQKVIRSAEDLPEAQQLA
NSAQCVLEEFVNFDLEISVIVSGNGQDVTVFPVQENIHRNNILSKTIVPARISDQLADKA
KKMAVQIAKKLQLSGTLCVEMFATADDIIVNEIAPRPHNSGHYSIEACDFSQFDTHILGV
LGAPLPTIHLHAPAVMLNVLGQHVQQAIDYVTENPSAHLHMYGKLEAKHNRKMGHVTVFA
EDADEVEEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacaaggaaaaatcgcagaggagtcaagtggtgaactcatttaagaccattggg
attatcggtggtggtcagctggggcagatgatggcgattgcggctatctacatgggccat
aaggtcatcacgctggatcctgctaacgactgtcctgccgcccgcgttagcgaggtgatt
gtggcaccttacgatgatgttgaggctttgggacaattagctgcgcgttgcgatgttttg
acctatgagtttgagaatgtcgatgccgatggtctggatgccgttgtgtcagctggtcag
ctaccgcaggggactgatctgctccgcatttcccaaaaccgtatcgttgaaaaagacttt
ctgacaaataaggctggtgtgactgtcgctccttataaggtggtgacgtctagccttgac
ctagaggggcttgatttgaccaagacctatgtcctcaagacagcgacaggtggttatgac
ggtcatgggcaaaaggttattcgctccgcagaagacctaccagaggcgcaacaattagcc
aactcagctcagtgtgtcttggaagagtttgtcaattttgaccttgaaatctcagttatc
gtgtctggaaatggtcaggatgtgacggtctttcccgttcaggaaaatatccaccgcaat
aatatcctgtcaaaaaccatcgtgccagctcgtatctcagatcaactggctgataaggct
aagaaaatggcggtgcagattgccaagaaactccagctgtcaggaactctctgtgtggaa
atgtttgcgaccgcagatgatatcattgtcaatgaaattgccccacgtccccacaactca
gggcactactcaatcgaggcttgcgacttttcacagtttgacacccacattttgggcgtg
ctaggagcgccgctcccaaccatccacctccatgctccagccgtcatgctcaatgtcctc
ggacaacacgtccagcaggcgattgactatgtgactgaaaaccctagcgcccacctccac
atgtatggtaaactagaagcgaaacataaccgcaaaatgggacacgtgacggtgtttgca
gaagatgcggatgaggtggaggagttttag

DBGET integrated database retrieval system