KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0041Help
Entry
MGAS2096_Spy0041  CDS       T00357                                 

Definition
(GenBank) Alcohol dehydrogenase / Acetaldehyde dehydrogenase (acetylating)
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
spj00010  Glycolysis / Gluconeogenesis
spj00071  Fatty acid degradation
spj00350  Tyrosine metabolism
spj00620  Pyruvate metabolism
spj00625  Chloroalkane and chloroalkene degradation
spj00626  Naphthalene degradation
spj00650  Butanoate metabolism
spj01100  Metabolic pathways
spj01110  Biosynthesis of secondary metabolites
spj01120  Microbial metabolism in diverse environments
spj01130  Biosynthesis of antibiotics
spj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS2096_Spy0041
   00620 Pyruvate metabolism
    MGAS2096_Spy0041
   00650 Butanoate metabolism
    MGAS2096_Spy0041
  Lipid metabolism
   00071 Fatty acid degradation
    MGAS2096_Spy0041
  Amino acid metabolism
   00350 Tyrosine metabolism
    MGAS2096_Spy0041
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MGAS2096_Spy0041
   00626 Naphthalene degradation
    MGAS2096_Spy0041
Enzymes [BR:spj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MGAS2096_Spy0041
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MGAS2096_Spy0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABF35093
Position
58265..60907
Genome map
AA seq 880 aa AA seqDB search
MTEGHNTVETTSVSVTIDALVQKGLAALAEMRKLDQEQVDYIVAKASVAALDAHGELAKH
AYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTGLTLIAEPVGVICGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWVET
PSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYDDFVAEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKPATWIAEQAGFTVPEGTNILAAECKEVSENEPLTREKLSPVIAV
LKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNAVGDNVSAVNLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFAEVEPDPDITTVMKG
TELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGFIAA
DTGMDVLTHATEAYVSQMANDFTDGLALQAIKIVFDNLEKSVKTADFEAREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPASTPEEAVESYAKAVYDLGCRVGIQMNFKAQGIDENEWKEHSRELA
YLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYAERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaggacataatactgttgaaacaacctctgtttctgtgacaattgatgctctt
gttcaaaaaggtttagctgctcttgcagagatgcgtaagcttgaccaagaacaagttgac
tatatcgtagccaaagcttctgttgctgctttggatgctcacggtgaacttgctaaacat
gcttatgaagaaacaggtcgcggtgtctttgaagataaagcaacaaaaaatctatttgct
tgtgagcatgtggttaataacatgcgccatcaaaaaacagtaggaattattgaagaagat
gatgtgacaggtttgacattaattgctgagccggttggtgttatctgtgggattacaccc
acaactaacccaacttcaacagctatctttaaatctttgatctcgttaaaaacacgtaat
ccaattatttttgcctttcacccatcagcacaagaatcatcagcacatgccgctcgtatt
gttcgtgatgctgctattgccgctggtgctcctgaaaattgtgtgcagtgggttgaaaca
ccatcacttgaagcaacaaatgctttgatgaatcatgacggcattgccactatccttgcg
acaggtggaaatgcgatggttaaagcggcatactcatgtgggaaacctgcccttggggta
ggtgctggtaacgttccagcttatgttgaaaaatcagctaatatccgtcaagccgctcat
gatattgtgatgtctaaatcatttgataatggtatggtctgtgcctctgaacaagctgtt
atcatcgataaagaaatctatgacgattttgtagcagaattcaaatcttaccatacttat
tttgtaaataaaaaagaaaaagcccttcttgaagaattctgttttggtgccaaagcaaat
agcaaaaactgtgctggtgcaaaattaaatccaaatattgtaggaaaaccagctacttgg
attgcagaacaagctggatttactgttccagaaggaaccaatattcttgctgcagaatgt
aaagaagtttcagaaaatgagcctttaacacgtgaaaaattatctccagtcattgctgtt
ttgaaatctgaatcacgtgaagacggtgttgaaaaagctcgtcaaatggttgaatttaat
ggacttggtcactcagctgccattcatacagcagatgcagagttggcaaaagaatttggt
actagaattcgtgctatccgtgtcatctggaattcaccttctacatttggtggtatcggt
gatgtttacaatgctttcttaccatcattgactcttggttgtggttcgtatggacgtaac
gcagttggtgataacgttagtgctgttaatctcttgaacatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagtcccttcaaaaacatacttcgaacgtgattcaatt
caatatttgcaaaaatgtcgtgacgttgaacgtgtcatgattgttacagatcacgctatg
gttgagcttggtttcttggatcgtatcattgaacaacttgatcttcgtcgcaataaagtt
gtttatcagatctttgctgaagtagaaccagatccagacattacaactgttatgaaaggt
actgaattaatgcgtaccttcaaaccagacaccattattgcccttggcgggggatctcct
atggatgcagccaaagttatgtggctcttctacgagcaaccagaagttgatttccatgac
ctcgttcaaaaattcatggatatccgcaaacgtgcgttcaaattcccagaacttggtaag
aaaacaaaatttgttgctatcccaacaacttctggaacaggttcagaggtgacaccattt
gctgttatctctgacaaagcaaataatcgtaaatatccaatcgctgattactcattaaca
ccaactgtagccattgttgacccagctttggtattgactgttccaggctttattgctgct
gatactggtatggacgttttgacacacgcaaccgaagcttacgtgtcacaaatggccaat
gactttacggatggtttagctcttcaagccattaaaattgtttttgataatcttgaaaaa
tcagttaaaacagccgattttgaagcacgtgaaaagatgcacaatgcgtcaactatggca
ggtatggctttcgccaatgcattcttaggtatttctcactcaatggcgcataaaattggc
gcacaattccataccgtacacggacgtacaaatgcaattcttttgccgtatgttatccgc
tataatggaactcgtccagctaaaacagcaacatggcctaagtataattactaccgtgcg
gatgaaaaataccaagacattgcgaaattgttagggcttccagcttctacaccagaagaa
gcagtggaatcttatgcgaaagctgtttatgatctgggttgccgagttggtattcaaatg
aacttcaaagctcaaggtatcgacgaaaacgaatggaaagaacattctcgtgaattggct
taccttgcttatgaagaccaatgttcacctgctaacccacgtcttccaatggttgatcac
atgcaagaaattattgaagatgcttactatggttatgctgaacgtccaggacgacgtaag
tga

DBGET integrated database retrieval system