KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0042Help
Entry
MGAS2096_Spy0042  CDS       T00357                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:spj01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spj00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:spj00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:spj00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:spj00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:spj00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61102..61566
Genome map
AA seq 154 aa AA seqDB search
MYNLFVTDYKKVIIRWRTDMKAVVVNQASTGVEVVEHDLPNVGHGKALVKVEYCGVCHTD
LHVAHGDFGQVPGRILGHEGIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRE
TLCRSVKNAGYSVDGGMSEYAVVTADYAVKVPEG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatttatttgtaaccgattacaaaaaagtcattattagatggaggactgatatg
aaagccgtagttgttaatcaagctagtacaggtgtcgaagttgttgagcatgatcttcca
aatgttggtcatggtaaagcgcttgttaaagtagaatactgtggcgtttgtcatactgat
ttacacgttgcacatggcgattttggtcaggtaccaggacgtattttggggcacgaaggt
attggtatagtagaagaaattggagaaggcgtaacatccttaaaggttggtgatcgtgtc
tctattgcatggttctttgaaggatgtggtcattgcgaatactgtactacaggacgtgag
acactttgtcgtagtgttaaaaatgctggatacagtgttgatggaggaatgagtgaatat
gcagtagtaacagctgattatgcagttaaagttccagaaggttag

DBGET integrated database retrieval system