KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0042Help
Entry
MGAS2096_Spy0042  CDS       T00357                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MGAS2096_Spy0042 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS2096_Spy0042 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    MGAS2096_Spy0042 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MGAS2096_Spy0042 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MGAS2096_Spy0042 (adhA)
   00626 Naphthalene degradation
    MGAS2096_Spy0042 (adhA)
Enzymes [BR:spj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MGAS2096_Spy0042 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61102..61566
Genome map
AA seq 154 aa AA seqDB search
MYNLFVTDYKKVIIRWRTDMKAVVVNQASTGVEVVEHDLPNVGHGKALVKVEYCGVCHTD
LHVAHGDFGQVPGRILGHEGIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRE
TLCRSVKNAGYSVDGGMSEYAVVTADYAVKVPEG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatttatttgtaaccgattacaaaaaagtcattattagatggaggactgatatg
aaagccgtagttgttaatcaagctagtacaggtgtcgaagttgttgagcatgatcttcca
aatgttggtcatggtaaagcgcttgttaaagtagaatactgtggcgtttgtcatactgat
ttacacgttgcacatggcgattttggtcaggtaccaggacgtattttggggcacgaaggt
attggtatagtagaagaaattggagaaggcgtaacatccttaaaggttggtgatcgtgtc
tctattgcatggttctttgaaggatgtggtcattgcgaatactgtactacaggacgtgag
acactttgtcgtagtgttaaaaatgctggatacagtgttgatggaggaatgagtgaatat
gcagtagtaacagctgattatgcagttaaagttccagaaggttag

DBGET integrated database retrieval system