KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0044Help
Entry
MGAS2096_Spy0044  CDS       T00357                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MGAS2096_Spy0044
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS2096_Spy0044
  Lipid metabolism
   00071 Fatty acid degradation
    MGAS2096_Spy0044
  Amino acid metabolism
   00350 Tyrosine metabolism
    MGAS2096_Spy0044
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MGAS2096_Spy0044
   00626 Naphthalene degradation
    MGAS2096_Spy0044
Enzymes [BR:spj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MGAS2096_Spy0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61958..62176
Genome map
AA seq 72 aa AA seqDB search
MELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGAEGLVVPIVEKVPVDTAPEVFDEMERG
LIQGRKVLDFIS
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atggaactgtctatcgtaaaaactgttttagatggtatcaaagtggtcggatcacttgta
gggacacgtaaagacttggaagaagcctttgcctttggtgcagaaggtctggttgttccg
attgtcgaaaaagttccagttgacactgctccagaagtctttgatgaaatggaacgtggt
ttaatccaagggcgcaaggtcttagatttcatcagctaa

DBGET integrated database retrieval system