KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0078Help
Entry
MGAS2096_Spy0078  CDS       T00357                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS2096_Spy0078
Enzymes [BR:spj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MGAS2096_Spy0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86872..87180
Genome map
AA seq 102 aa AA seqDB search
MKHRFQVKRGVSVYLEKRIPMCAGMGGGSSDAVTIRALNQLWLLTLSRKDMMDIGIPIGS
DVPYCLLSGCAQVTGKGEVVCRILGLLSSWVVLVKPDFGIST
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcgatttcaagttaaaagaggagtttccgtttacttggaaaagcggattccc
atgtgtgctggtatgggaggaggttctagcgatgctgttactatcagagcattaaatcag
ttatggctccttactcttagccgaaaagatatgatggatattggtataccgattggtagt
gatgtgccttattgcttgctttcaggttgtgcccaagtcactggtaaaggtgaagtggtt
tgtcgcattttggggctgttatcgtcttgggtggttttggttaaaccagattttggtatc
tcgacttga

DBGET integrated database retrieval system