KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0218Help
Entry
MGAS2096_Spy0218  CDS       T00357                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:spj00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
217287..218051
Genome map
AA seq 254 aa AA seqDB search
MMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALL
GWNPGGEEEIFSREQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETVYALCKPF
LEEAGRLTEKAEKLVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAGETVSTVLQ
AFKAKLEAMSDEDFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYL
LGRDKSIEHIKNML
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgatggtctatgaagctcttggctgggaagcgccagagtttggtcatatgactcttatc
atcaattctgaaacgggtaaaaaattatcaaaacgcgacaccaataccctccaattcatt
gaagattaccgcaaaaaaggttatatgcctgaagctgtctttaacttcatcgcccttctt
ggctggaatcctggcggagaagaggaaatcttctctcgtgagcaactgattgcccttttt
gatgaaaatcgccttagcaagtcgccagctgcctttgaccagaagaaaatggattggatg
agcaatgagtatcttaaacatgcggattttgaaacagtttatgccctctgcaaacctttc
cttgaagaggcaggccgtttgacagaaaaagctgagaagctagtagaattatacaaacct
caattaaaatctgcagatgagattattccattgactgaccttttcttttctgatttccct
gaattaacagaagccgaaaaagaagtgatggcaggtgaaacagtttcgacagtcttgcaa
gctttcaaggctaagttggaagctatgtcagatgaagacttcaaaccagaaaatattttc
ccacaaattaaggctgttcaaaaagaaacaggaatcaaaggaaaaaacctctttatgcct
attcgtattgcagtatctggtgaaatgcatggcccagaattaccaaatacgatttattta
ttgggacgtgataaatccattgagcacatcaaaaacatgctataa

DBGET integrated database retrieval system