KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0735Help
Entry
MGAS2096_Spy0735  CDS       T00357                                 

Gene name
mur1-2
Definition
N-acetylmuramidase (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Brite
Enzymes [BR:spj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     MGAS2096_Spy0735 (mur1-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709123..709830
Genome map
AA seq 235 aa AA seqDB search
MTKKKGKLVLISLFVLAACLGAYSAMRQSHKTSNVSAETIASSSTRHFIDEIGPTASTIG
QERDLYASVMIAQAILESSNGKSSLSQAPYYNFFGIKGAYNGSSVTMSTWEDDGNGNTYT
IDQAFRAYPSIADSLNDYADLLSSSTYIGARKSNTLSYQDATAALTGLYATDTSYNLKLN
NIIATYGLTAYDVANSSAQETGLATSGYVWNEYRRNYTDAETLAVDEAWAKRMTY
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaagaaaggtaagcttgtacttatcagtctttttgttctagcagcttgttta
ggagcttatagtgcaatgagacaatctcataaaacttcaaacgtgtcagctgagactatc
gccagttcttcaacccgacattttattgatgaaattggtccaactgctagtactattggt
caagaacgtgatctttatgcgtctgttatgatagcacaagcgattttagaatcaagtaat
ggtaaatcaagtctaagtcaagcaccttattataattttttcggtattaagggtgcctat
aacggttcttctgtgacgatgtcaacttgggaagatgatggtaatggcaatacctatacg
attgatcaagcctttagagcttatccaagtattgcagactcccttaatgactatgcagac
ttgctaagttctagcacttatataggtgctagaaaatcaaacacgctatcgtatcaagat
gctacagcagctctaactggcttatacgctacagacaccagttataacttaaaactaaat
aatattattgcaacctatggtttgacggcttatgatgttgctaatagctcagctcaagaa
actggtctagcaacttcgggttatgtttggaatgagtatcgtcgtaattacactgatgcg
gagaccctagcagttgatgaggcttgggctaaacgcatgacttattaa

DBGET integrated database retrieval system