KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0809Help
Entry
MGAS2096_Spy0809  CDS       T00357                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MGAS2096_Spy0809
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MGAS2096_Spy0809
Enzymes [BR:spj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MGAS2096_Spy0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
777480..777644
Genome map
AA seq 54 aa AA seqDB search
MTETFFDKPLACREIKEIPGLLEFDIPVRGDNRGWFKENFQRKNVANWLSRTFF
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaactttttttgacaaaccattggcttgccgagaaatcaaagaaatcccaggc
ttactagagtttgatattcctgttcgtggggataatcgtggctggtttaaagaaaatttc
caaagaaaaaatgttgccaattggctttccagaacgtttttttga

DBGET integrated database retrieval system