KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0809Help
Entry
MGAS2096_Spy0809  CDS       T00357                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:spj00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:spj00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
777480..777644
Genome map
AA seq 54 aa AA seqDB search
MTETFFDKPLACREIKEIPGLLEFDIPVRGDNRGWFKENFQRKNVANWLSRTFF
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaactttttttgacaaaccattggcttgccgagaaatcaaagaaatcccaggc
ttactagagtttgatattcctgttcgtggggataatcgtggctggtttaaagaaaatttc
caaagaaaaaatgttgccaattggctttccagaacgtttttttga

DBGET integrated database retrieval system