KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0898Help
Entry
MGAS2096_Spy0898  CDS       T00357                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
862873..863373
Genome map
AA seq 166 aa AA seqDB search
MTIVYLSLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTGQADFLNMACQ
LDTQLTAADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTE
RAFVLIPLLELQPDLKLPPNHKFLRDYLAALDQSDITLFSAQQTEF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgtttatttaagtttaggcaccaatatgggggaccgagcagcttacttgcaa
aaagctcttgaggctttagctgacttacctcaaacacggttgcttgctcaatcatccatt
tatgaaacgactgcttggggcaagacaggccaggctgattttctcaatatggcctgtcaa
ttagatacacaattaaccgcggctgatttcttaaaagaaacacaagctattgagcaatct
cttggtcgtgtgaggcatgaaaaatggggatcaagaactattgacattgatatcttgcta
tttggagaagaggtttatgacacaaaggaattgaaagtgccacacccttatatgactgag
cgtgcttttgttttaatccccttattggaattgcagccagatttaaaattgcctcctaat
cataagtttttaagggattatcttgcagctttagatcaatcagatatcacgctcttttca
gctcaacagacagagttctag

DBGET integrated database retrieval system