KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0909Help
Entry
MGAS2096_Spy0909  CDS       T00357                                 

Definition
Zn-dependent alcohol dehydrogenases and related dehydrogenases
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MGAS2096_Spy0909
Enzymes [BR:spj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     MGAS2096_Spy0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(873238..874329)
Genome map
AA seq 363 aa AA seqDB search
MNWLITSQPYKELNMKAATYLSTGNLQLIDKPKPVIIKPTDAIVQLVKTTICGTDLHILG
GDVPACKEGTILGHEGIGIVKEVGDAVTNFKIGDKVIISCVTSCHTCYYCKRGLSSHCED
GGWILGHLINGTQAEYVHIPHADGSLYHAPDTIDDEALVMLSDILPTSYEIGVLPSHVKP
GDNVCIVGAGPVGLAALLTVQFFSPANIIMVDLSQNRLEAAKTFGATHTICSGSSEEVKA
IIDDITNGRGVDISMECVGYPATFDICQKIISVGGHIANVGVHGKPVDFNLDELWIKNIT
LNTGLVNANTTEMLLNVLKTGKIDATRLITHHFKLSEVEKAYETFKHAGANNALKVIIDN
DIS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaattggttgattacctctcaaccttataaggagttaaatatgaaagcagcaacttat
ctttcaaccggaaatctacagctcatagacaaaccaaaaccagtcattataaagcctaca
gatgctatcgtccagttggtaaaaaccactatttgtggaactgatttgcatatcttaggt
ggggatgttcccgcatgtaaagaaggaacaatccttggtcatgaaggaattggaattgtt
aaggaggtcggtgatgcggttactaactttaaaatcggagataaagtgattatttcttgc
gtcacatcatgtcatacctgttattattgtaaacgaggcctttcgtcacattgtgaagat
ggcggttggattcttggccatttaattaatggaacacaagcagaatatgtccatatccca
catgcagatggtagtctctatcatgctcctgatacgattgatgatgaggcacttgtcatg
ctttctgatattttaccaacttcatatgaaattggtgtcttgccatcacatgtcaagcct
ggagataatgtttgtattgttggtgccggtccagtaggactcgcagccctactaaccgtt
caatttttctctccagccaatattattatggtcgacttatctcaaaatcgccttgaagca
gctaaaacatttggagccacacacacgatttgttcaggaagtagtgaagaagtcaaggct
atcattgacgatataaccaatggacgtggtgtcgatatttccatggagtgtgttggttat
cccgcgacatttgatatttgtcaaaaaattatatcagtaggtgggcatattgctaacgtt
ggggttcatgggaaaccagttgatttcaacctggatgaattatggattaaaaatatcacc
ttaaacactggacttgttaatgccaatacaactgaaatgctactaaatgtcttgaaaact
ggaaagattgacgcaacaagacttattacacatcattttaaactttcagaagttgaaaaa
gcttatgaaacctttaaacatgctggtgcaaataacgccttgaaagttattattgataat
gatattagctaa

DBGET integrated database retrieval system