KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0936Help
Entry
MGAS2096_Spy0936  CDS       T00357                                 

Gene name
tdk2
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MGAS2096_Spy0936 (tdk2)
Enzymes [BR:spj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MGAS2096_Spy0936 (tdk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
897255..897824
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAI
PISNDMDIFTFIAQLEEKPYCVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPEI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagttgctcataactatgaagaacaaggcaaacctgttgtcattatgacaagtgctctt
gatacacgtgatggttttggcatcgtctcaagccgtattggtatgcgacgagaagctatc
cccatttcaaatgacatggatattttcacatttattgcccaattggaggaaaaaccttat
tgtgtcctgattgacgaaagccaatttttaagcaagcaaaatgtttatgatttggcgcgt
gtggtggatgagctaaatgttcctgtcatggcttttggtttgaaaaatgatttccaaaac
aatctttttgaaggttcaaaacatttgctattattggccgataagattgatgaaatcaaa
acaatttgccaatactgtagtaagaaagcaaccatggttttaaggacagaaaatggaaaa
cctgtctatgaaggtgatcagatacaaattggtggtaatgaaacatatatcccagtttgt
cgaaaacattattttaatccagagatttaa

DBGET integrated database retrieval system