KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1058Help
Entry
MGAS2096_Spy1058  CDS       T00357                                 

Gene name
malM
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1019790..1020530)
Genome map
AA seq 246 aa AA seqDB search
MALVKMVSCGNPTYNWSAHEKSNFAWWIYRIQESFKLYDQLRIDHFKGFSDFWEIPAGDK
TARNGHWASAPGIALFSAVREALGELPIIAENLGYIDEKAEQLLASTGFPGMKILEFGLF
DITSQSIDLPHYYDRNCVAYTGTHDNEVVNGWYDNLSEGQVHFVNNYLHKHADESITKAM
LRTIFASVCDTAILCIQDLLDKDGKSRMNMPNTIGGNWQWRMLDGELNQDHKDYLIYLTD
LYGRAR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggctttagtgaagatggtcagctgtggaaatccaacctacaattggtctgctcatgaa
aagtctaattttgcatggtggatttatcgtattcaagaaagtttcaaactatatgatcag
ctaagaatcgatcattttaaaggcttctcagatttttgggaaattcctgctggtgataaa
actgctagaaatggccattgggcctcagccccaggtatagcgttattttctgcggttcgt
gaggccttaggagagcttcctatcatcgcagaaaaccttggttatattgatgaaaaagca
gagcagctattagcatcaacaggctttcctggcatgaagatattagaatttggtttattt
gatataacgagtcaaagtatagatttgccacattactatgaccgtaattgtgtcgcttac
acagggactcatgataacgaggtggttaacggatggtatgacaatcttagtgaaggacaa
gtacactttgtaaataactatcttcacaaacatgcagatgaaagtattacaaaagccatg
ctaagaacaatctttgcttctgtttgtgatacagccattctttgcatccaagatttatta
gataaagatggtaagagtcgtatgaatatgccaaatacaattggaggtaattggcaatgg
cgtatgcttgacggtgaattgaaccaagatcacaaagactaccttatttatttaacagat
ctttatggtcgcgcaagataa

DBGET integrated database retrieval system