KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1059Help
Entry
MGAS2096_Spy1059  CDS       T00357                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MGAS2096_Spy1059
Enzymes [BR:spj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MGAS2096_Spy1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1020472..1021059)
Genome map
AA seq 195 aa AA seqDB search
MLVDDELLEAADLCDITFGTNPEAVDYAQLFQVRRPLLEKAVRAFVAEQENVCKLEAFET
ASSWLTDFAEFMALKEYFNNKALQDWDDETVIKRQEDSLNNYRELLAKKITYHKVCQYFF
YQQWSALKTYANHKGIEIIGDMPIYVSADSVEVWTMPELFKVDSDKKPLFIAGVPADGFS
EDGQLWKSNLQLVCS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttgctagtagatgatgaacttttagaagcagcagatttgtgtgatattacattcggcaca
aatcctgaagcagtagactatgctcagctttttcaagttaggcgtccacttttagaaaaa
gcagtgagagcttttgttgctgaacaagaaaatgtgtgtaaattagaagcttttgaaaca
gcttctagctggttaactgattttgctgaatttatggctttaaaagaatattttaacaat
aaagccttacaagattgggacgacgaaactgtcattaaacgccaagaagactcacttaat
aattaccgtgagttgcttgcaaaaaagattacctatcataaagtctgtcaatacttcttt
taccaacaatggtcagccttgaaaacttacgctaaccataaagggatagaaattattggt
gatatgcctatttatgtttctgcggacagtgtagaagtttggacgatgcctgagctattt
aaagtagatagtgataaaaagccattgtttattgcaggtgtaccagcagatggctttagt
gaagatggtcagctgtggaaatccaacctacaattggtctgctcatga

DBGET integrated database retrieval system