KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1277Help
Entry
MGAS2096_Spy1277  CDS       T00357                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGAS2096_Spy1277 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS2096_Spy1277 (glcK)
   00052 Galactose metabolism
    MGAS2096_Spy1277 (glcK)
   00500 Starch and sucrose metabolism
    MGAS2096_Spy1277 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MGAS2096_Spy1277 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MGAS2096_Spy1277 (glcK)
   00524 Butirosin and neomycin biosynthesis
    MGAS2096_Spy1277 (glcK)
Enzymes [BR:spj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MGAS2096_Spy1277 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1232682..1233653)
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTIKFGILTAAGEVQEKWAIETNILEGGKHIVPDIVASIKHRLDLYGL
SSADFVGIGMGSPGAVDRDTNTVTGAFNLNWKETQEVGSVVEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSAIKAAIDNGEGVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattactggggattgatttaggtggtaccaccattaaatttggaatttta
acagcagcaggagaagtccaagaaaaatgggcaattgagactaatattttagaaggaggc
aagcatattgttcccgatattgtagcttccatcaaacatcgcttagacttgtatggtcta
agcagtgctgattttgtgggaattggtatgggatcaccaggagcggttgaccgtgatact
aatacagttactggggcattcaaccttaattggaaagaaacccaagaagtcggttccgtt
gttgaaaaagaattgggcattccttttgccattgacaatgatgctaatgtggctgccctt
ggtgaacgttgggtaggtgctggtgaaaataacccagatgtcgtcttcatgacacttgga
acaggtgtcggtggaggcattattgctgatggtaacttgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgagccagaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcttcagcaacaggagttgtcaaagtggcacgttta
ttggcagaagcttatgaaggggattcagccatcaaagcagctattgacaatggtgaaggt
gttaccagcaaagatatttttatggcagctgaagcaggggattcctttgctgattctgtt
gtggaaaaggttggttactaccttggccttgcttcagcaaatatttccaatatattgaat
ccagactcagtggttatcggtgggggtgtgtcagcagcaggagaatttctacgctcacgt
attgaaaaatactttgtgaccttcactttcccacaagtgaggtattcaactaaaattaag
attgcagagcttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacaaaatag

DBGET integrated database retrieval system