KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1324Help
Entry
MGAS2096_Spy1324  CDS       T00357                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spj00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:spj00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1276707..1280213)
Genome map
AA seq 1168 aa AA seqDB search
MVYRQKSSEIVTRTITKPSRATSNIKQEIDMTPDSKEQTVTGYQYHYIDQEGRKQPFNQG
WRFLMADVACAQAPSFDDSNWQVIHLPHDFSLTQPYTRNGEAESAYKLGGVGWYRHYLVL
DEVLAGCHVAITFEGSYMETEIYVNGQFIGKHLNGYQEFTYDISDVVTFGAENLLAVRVE
NKVPSSRWYSGSGLYREVSLSVLPQLHFVADQVAMTLADTAVQEKGQQKVDLRFALNQPI
QTCHYQLSLCLWEQSHCSKDKKLLYQETEVPLADLAFQRQYGLTLSLEELQLWSPDNPHL
YDLELTLYYQGQVIDCFCLETGFRQLTFTANQGLFVNGRAVKLKGVCLHHDQGGLGACAY
EDALARQLVLLKDMGANTIRSTHNPSSPKLRQLANRLGFFVIEEAFDTWTYAKNGNVNDF
SNYFHQTIGTENANYLQRVRSPETSWAQYSIEAMVWSAKNDPSVLMWSIGNELMEGFSAD
VSHYPELTRQMCQWIAAIDTSRPITFGDNKLKEADFCWHEEVSQMATLLSQLDHPQGLIG
LNYANGKDYDKLHEEHSDWLLYGSETVSAITSRAYYKETKKVLDSGYHLTSYDHAKVDWG
AFASQAWYDTITRDFVAGECVWTGFDYLGEPTPWNKIDSGVVGLWPSPKNAYFGILDTAG
FPKDSYYFYQSQWVQGQTTLHLLPVWQKDQLCFDEQGLVEVVVYSNAASVQLMFEDEQGN
LTDYGRKAFHTYSTPTGHTYQLYQGADAAKNPHENLYLTWRVPYQKGLLRAVAYDISGKS
IPKTSGRSQVRTYGSVAKLSWKAFEAPIDAPWELLYLDLSLLDSQGELVSHAQDWLKVQV
EGPARLLALDNGNPTDHTPYQEPLRQAYGGKLLAILALTGEAGHIKVTAKASQQLSSVFQ
TQVACRAPKEHLVTLPLEKYQFKKSRLTSQQEIGQSCLKTTQFLSVLENKDTQQKAGKAS
TPHILITSYQHYLSLPLQVCSQAFDFKKGDDIFLPQWLQVKDAQGSFVKKAFPMTWCLKE
KIFAKPILVTGYVSCFGQSIPVEARLNLAQASKRRHQDLSLVAKQSLATSQKRLTYCYQY
DTVQAIGAISLQNHTGTSLSVSVAISYGSQSSIKQETLMLADSHLSQLEEVIFFDDILTV
LYLAVILEVIEGPDLTEDSIQIGLWDLV
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atggtttatcgccaaaagagttcagagatcgttacaaggacaattaccaagccatcaagg
gcgaccagtaacattaaacaggagattgatatgacaccagatagcaaggagcagacagtg
actggctaccaataccactatattgatcaagaaggaagaaagcagccctttaatcaaggc
tggcgttttcttatggcagatgtggcgtgtgctcaggccccttcttttgatgattcgaac
tggcaggtgattcatttaccacatgatttcagtcttacgcagccttacacaagaaatggt
gaagctgaaagtgcttataaattaggtggtgtcggttggtatcggcattatctcgtgtta
gatgaggttttagctggttgtcatgttgccattacttttgagggttcctatatggaaacg
gaaatttatgttaatgggcaattcattggcaaacacttaaatggctatcaggaatttacc
tatgatatctctgatgtagtgacttttggagctgaaaatcttctggctgtccgggttgaa
aacaaggttcccagttctcgttggtattcaggcagtggtctttatcgtgaagtgagtttg
tctgttcttccccagcttcattttgtggcagaccaggtagcaatgaccttggctgatact
gctgtgcaggagaaagggcaacagaaagttgatttacgctttgcccttaatcagcctatt
cagacttgccactaccaattgagcctctgtttatgggaacaatcacattgctcaaaagac
aaaaaactcctttatcaagaaacagaagtgcctctagctgatttggctttccaaagacag
tatggtcttacactgtctttggaagaactccaattgtggtcaccagataatcctcacctc
tacgatttagaactcactctttactatcaaggtcaggtcattgattgcttttgccttgaa
actggttttcgtcaactgacttttacggccaatcaggggctttttgtgaatggcagagct
gtcaaattaaagggagtttgtttgcatcatgaccaaggaggcctaggagcttgtgcttac
gaagatgccctagccagacaattagtcctgttgaaagacatgggggctaataccattcgt
agcacccataacccaagtagtcccaaacttaggcaactagccaatcgtctcggctttttt
gtgattgaagaagcctttgacacctggacctatgccaaaaatggaaacgttaatgacttt
tcaaactatttccatcagactatcggaactgaaaatgcaaactatcttcaaagagtgagg
tcacctgaaacgagctgggcccagtatagtattgaggccatggtctggtctgccaagaat
gacccgtcagtgttgatgtggtcgattggtaatgaattgatggaaggtttttcagccgat
gtcagtcattacccagagctgacaagacaaatgtgccaatggattgctgctattgacacc
tcacgtcccattacctttggggacaataaattaaaagaagctgacttttgctggcatgag
gaagtgtcgcaaatggcaactcttcttagtcaattagaccatccccagggactcattggg
ttaaactatgctaatggaaaagactatgataagcttcatgaggagcactctgattggctg
ttgtatggttctgaaacagtttcagccattaccagcagggcttattataaagagacaaaa
aaagttcttgactccggttatcacctaacctcttatgatcatgctaaggtcgattggggt
gctttcgctagccaggcttggtatgataccattacccgtgattttgttgctggcgaatgc
gtttggacaggctttgattatttaggagaacctacaccctggaacaagatcgacagcggt
gttgtaggcctttggccttctcctaaaaatgcctactttggcattttagacacggcaggc
tttccaaaagatagctattatttttaccaaagtcagtgggtgcaggggcagaccaccttg
cacctgttaccagtctggcagaaggaccagctttgtttcgatgagcagggattggtggag
gttgtggtttatagcaatgctgccagtgtgcaactgatgtttgaagatgagcagggcaac
ttaacagattatggaaggaaggcatttcatacttatagcacgccaacgggacacacttat
cagctttaccaaggagctgatgctgctaagaatcctcacgagaatctttacctgacttgg
cgagtgccctatcaaaaagggttgctaagggcagtggcctacgacatttctggtaaaagc
attccaaaaaccagtggacgttctcaggttagaacctatggttcagtggcaaagctatct
tggaaagcctttgaagcacctattgacgctccttgggaattgctttatctggatttatca
cttttggatagccaaggtgaattggtcagccatgctcaagattggctaaaggttcaagta
gaaggaccagcccgtttgttggctcttgataatgggaatccgactgaccacaccccttat
caggagcctctacgccaggcatatggcggaaaattattagccattttagccctcactgga
gaggcgggacacattaaggtcacggcaaaagcctcgcagcaacttagcagtgtttttcag
acacaagtagcctgccgtgcccccaaagaacacttagtgacactacctttagagaaatat
cagtttaaaaagagccgactgacaagtcaacaagaaattggtcaatcttgtctaaagacc
acacaattcctttctgttttggagaacaaagacacccagcaaaaagcaggtaaggctagc
acacctcacattcttatcactagttaccaacactatttatctctgcccttgcaggtttgt
tctcaggcatttgattttaaaaaaggcgatgatatcttcttgcctcagtggctccaagtc
aaagatgcccaaggttcttttgtgaaaaaagcttttccaatgacatggtgcctaaaagag
aaaatctttgccaagcctattcttgtcacgggctatgtttcttgttttgggcaatcaata
ccggttgaggcaaggcttaacctagcacaagctagcaaaagacggcaccaggatctcagt
ttagtcgccaagcaatccctggccacaagtcaaaaaaggctaacttattgctaccaatat
gatacggtgcaagccataggagccattagcttgcaaaatcacacaggcacatctcttagt
gtttctgtggcaatcagttatggtagtcagagctctattaagcaagaaaccttgatgcta
gctgatagccacttgagccagttagaagaggttattttcttcgatgatattttgactgtt
ttgtatctggcagtgatccttgaagtcattgaaggacctgacctaactgaagacagtatt
caaattggcctttgggatttagtatga

DBGET integrated database retrieval system