KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1331Help
Entry
MGAS2096_Spy1331  CDS       T00357                                 

Definition
RpiR family transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGAS2096_Spy1331
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS2096_Spy1331
   00052 Galactose metabolism
    MGAS2096_Spy1331
   00500 Starch and sucrose metabolism
    MGAS2096_Spy1331
   00520 Amino sugar and nucleotide sugar metabolism
    MGAS2096_Spy1331
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MGAS2096_Spy1331
   00524 Butirosin and neomycin biosynthesis
    MGAS2096_Spy1331
Enzymes [BR:spj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MGAS2096_Spy1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1287814..1288737
Genome map
AA seq 307 aa AA seqDB search
MRHDRLFYYNKGEHLMSLLCIDIGGTSLKFALCHNGQLSQQSSFPTPSSLEKFYQLLDQE
VARYSAYHFSGIAVSAPGAVNKEKGIIEGASAIPYIHHFKIQEVLEERLHYPISIENDAN
CAALAEATLGAGKGASSLAMLVLGTGVGGSLVIDGKIYHGAHLFGGEFGFMIMNDRYQTF
SQLGTVVNMAKRYSAIVNNGKDYTGKAVLALAEQGDHLAIKERQVFLQSLAIGIFNIQHA
FDPQLILIGGGVSQADFLLSAIEAELDKLYQAVEISDLRPQLAICHFKNEANLLGAAIDF
YQEHKEA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagacatgatcgtctattctactataataaaggagaacacctcatgagcttgttatgt
attgatataggaggcacttcccttaaatttgccctctgtcacaatggccaattaagccag
caaagcagctttcccactccctctagtctggaaaagttttaccaattactcgaccaagaa
gttgctcgttactctgcttaccatttctcaggtattgccgttagtgctcctggagcggtt
aacaaggaaaaaggtattatcgaaggtgccagcgctattccctacattcaccattttaaa
atacaagaggtcttagaagaacggctacattaccctatttctatcgaaaatgatgccaat
tgtgccgccttagctgaagctaccttaggggcaggaaaaggcgctagtagcctagccatg
ctcgttcttggtactggagttggaggaagcttggtcattgatggcaagatttaccatggt
gcccacttatttgggggcgaatttggtttcatgatcatgaacgaccgctaccaaaccttt
agtcagttagggacagtggtaaatatggccaagcgctatagtgcaatcgtcaataacgga
aaagattatactggcaaagctgtccttgccctcgcagaacaaggagaccacctagcaatc
aaagaaaggcaggtctttctccaaagtttagccatcggtatttttaacattcaacacgcc
tttgatcctcaactgattttaatcgggggtggtgtttcccaagctgactttctactgtca
gcgattgaagctgaactagacaaactctaccaagccgtcgaaatctccgaccttagaccc
caattagctatttgtcactttaaaaacgaagccaatcttcttggagctgccattgatttt
taccaagaacacaaggaggcctaa

DBGET integrated database retrieval system