KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1368Help
Entry
MGAS2096_Spy1368  CDS       T00357                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MGAS2096_Spy1368
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MGAS2096_Spy1368
Enzymes [BR:spj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     MGAS2096_Spy1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1333020..1333778
Genome map
AA seq 252 aa AA seqDB search
MHLSLVLQAELENNRFTFLKEGKTVVFSDINQEKLDQVVADYTKEGYDAFSVVCDVTKEV
AINAAIDTVVEKYGRIDILVNNAGLQHVAMIEDFPTEKFEFMIKIMLTAPFIAIKRAFPT
MKAQKHGRIINMASINGVIGFAGKSAYNSAKHGLIGLTKVTALEAADSGITVNAICPGYV
DTPLVRGQFEDLSKTRGIPLENVLEEVLYPLVPQKRLIDVQEIADYVSFLASDKAKGVTG
QACILDGGYTAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgcatttatcactggtgctgcaagcggaattggaaaacaaccgttttaccttcttaaaa
gaaggtaaaacggttgttttttctgacattaatcaagaaaaactggatcaggttgttgct
gactatactaaagaaggctatgacgcttttagtgttgtgtgcgatgtcaccaaagaagta
gccatcaatgctgctattgatacggttgttgaaaaatatggtcgtattgatattttggtt
aacaacgcaggccttcaacatgttgccatgattgaagattttccaactgaaaaatttgaa
ttcatgattaaaatcatgttgacagcaccatttattgccattaaacgtgcttttcctaca
atgaaagctcaaaaacacggtcgtattattaatatggcttctatcaatggtgtcattggt
tttgctggcaaatccgcctacaattcagctaagcacggcttgatcggtctgaccaaagta
actgccttagaagctgctgattcaggcattacggtcaatgccatttgtcctggatatgtt
gacacaccactggttcgtggccagtttgaagacctttccaaaacaagaggtattcccctt
gaaaatgttcttgaagaagtgctatacccacttgttcctcaaaaacgcctcattgacgtt
caagaaattgcagactatgtgtctttccttgccagtgataaggcaaaaggtgttacaggt
caagcctgtatcttagacggtggctacactgctcaataa

DBGET integrated database retrieval system