KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1394Help
Entry
MGAS2096_Spy1394  CDS       T00357                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:spj01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:spj00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1359630..1360457)
Genome map
AA seq 275 aa AA seqDB search
MGMMKRQFEDVTRIVIKIGTSSLVLPTGKINLEKIDQLAFVISSLMNKGKEVILVSSGAM
GFGLDILKMEKRPTNLAKQQAVSSVGQVAMMSLYSQIFAHYQTNVSQILLTRDVVVFPES
LANVTNAFESLISLGIVPIVNENDAVSVDEMDHATKFGDNDRLSAVVAGITKADLLIMLS
DIDGLFDKNPTIYEDAQLRSHVAVITQEIIASAGGAGSKFGTGGMLSKIQSAQMVFENKG
QMVLMNGANPRDILRVLEGQPLGTWFKQIEEVTHD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgggtatgatgaaacgacaatttgaagatgtaacacgtatcgtaattaaaattggcact
agttcattagtgctaccaacaggtaaaatcaatttggaaaaaatcgaccaactggctttt
gtgatttcaagtttgatgaataagggcaaggaagttattttagtatcatcgggagcgatg
ggatttggactagatattttgaaaatggaaaaacgtccgaccaatcttgctaaacaacag
gcagtttccagtgttggtcaggtggccatgatgagtctttattcacaaatttttgcacac
taccaaaccaacgtgtcacaaattttattgacgagagatgtggtggttttcccagaaagt
ctagccaatgttaccaatgcttttgaaagtctgattagtttgggcattgtgccgattgtt
aatgaaaacgatgcggttagtgtggatgaaatggatcatgcgactaaatttggagataat
gaccgtttatctgctgtcgttgctggtattacaaaagctgatttattaatcatgttgtct
gatattgatggcctttttgataaaaaccctactatttatgaggatgcgcagttacgcagt
catgttgcagtcattacgcaagaaatcattgcgtcagcaggtggtgcgggcagtaaattt
ggcacaggtgggatgcttagcaaaattcagtctgctcagatggtatttgaaaacaaagga
cagatggtcttgatgaatggagctaatcccagagatattttaagagtgcttgaagggcaa
ccactaggcacctggttcaagcagatagaagaggtaacacatgactga

DBGET integrated database retrieval system