KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1534Help
Entry
MGAS2096_Spy1534  CDS       T00357                                 

Gene name
gatB
Definition
aspartyl/glutamyl-tRNA amidotransferase subunit B (EC:6.3.5.-)
Orthology
K02434  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:spj00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1478263..1479702)
Genome map
AA seq 479 aa AA seqDB search
MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGI
KAALALNMDIHKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIKIKLEDGSTKKIRIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEIIQYTG
ISDVKMEEGSMRVDANISLRPYGQEQFGTKTELKNLNSFSNVRKGLEFEVERQAKLLRSG
GVIRQETRRYDEANKGTILMRVKEGAADYRYFPEPDLPLYEIDDAWIDEMRAQLPQFPAQ
RRAKYEEELGLSAYDASQLTATKVLSDYFETAVSLGGDAKQVSNWLQGEVAQFLNAEGKT
IEEIALTPENLVEMIAIIADGTISSKMAKKVFVHLAKNGGSARAYVEKAGLVQISDPAVL
VPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATKGQANPQVAQQLLAQELQKLRD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaaccattattgggcttgaagtccatgtggaattaaataccaattccaaa
attttctcaccttcgtcagctcactttggtgaggacccaaatgccaacacgaatgtgatt
gattggtcttttccaggggtcttaccagtcatgaacaaaggcgttattgatgcgggcata
aaagctgcgcttgccctcaatatggacatccataaagagatgcactttgaccgcaaaaat
tatttctacccagataatcctaaagcttatcaaatttcacagtttgatgagccgattggc
tacaacggatggattaagattaaattggaagacggttcaaccaagaaaattcgtattgaa
cgcgcacacttggaagaagatgctggtaaaaacactcacggcacagatggttattcttat
gtagaccttaaccgccaaggagttcctttgattgagattgtgtcagaagccgacatgcgt
tctcctgaagaagcctatgcttatttgacagctctgaaagaaatcatccagtatacgggt
atttctgacgtcaagatggaagaaggctctatgcgggtggatgccaatatttcccttcgt
ccttacgggcaagaacaatttggaacaaagactgaattgaaaaacttgaactccttctca
aatgtccgtaaagggcttgaatttgaggtggaacgtcaagccaaactcttgcgttcaggt
ggggtgatacgccaagaaacgcgccgctatgacgaagcgaataaggggactattttgatg
cgggtcaaagaaggggcagcggactatcgttatttcccagaaccagacctacccttgtat
gagattgatgatgcttggattgacgagatgcgtgctcaattacctcaattcccagctcaa
cgtcgtgctaaatacgaagaggaacttggtctctcagcttatgatgctagccagctaaca
gctaccaaagtcttgtcagattactttgaaactgcagtaagtcttggtggcgatgccaag
caagtctctaactggttgcaaggagaagttgcccaattcttaaatgcagaaggcaaaacc
attgaagaaatcgctctgacaccagaaaatttggtggagatgattgctatcattgctgat
ggtacaatctcttctaaaatggctaagaaggtctttgtgcatttggctaaaaatggtggc
tcagctcgcgcctacgtcgaaaaggcaggacttgttcagatttctgatcccgctgttttg
gtaccaattattcaccaagtctttgctgataatgaagctgcagtggctgatttcaaatca
ggcaaacgtaatgctgataaggctttcacaggcttcttgatgaaggcaaccaaaggtcaa
gctaatccacaagtcgctcaacaattattagcacaagaattgcaaaaattgcgagattga

DBGET integrated database retrieval system