KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0041Help
Entry
MGAS9429_Spy0041  CDS       T00358                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MGAS9429_Spy0041 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS9429_Spy0041 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    MGAS9429_Spy0041 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MGAS9429_Spy0041 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MGAS9429_Spy0041 (adhA)
   00626 Naphthalene degradation
    MGAS9429_Spy0041 (adhA)
Enzymes [BR:spk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MGAS9429_Spy0041 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61128..62201
Genome map
AA seq 357 aa AA seqDB search
MYNLFVTDYKKVIIRWRTDMKAVVVNQASTGVEVVEHDLPNVGHGKALVKVEYCGVCHTD
LHVAHGDFGQVPGRILGHEGIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRE
TLCRSVKNAGYSVDGGMSEYAVVTADYAVKVPEGLDPAQASSITCGGVPTYKAIKEAGAA
PGQWIVIFGAGGLGNLAVQYAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVP
GYIQEKTGGAHGVVVTAVSKVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKV
VGSLVGTRKDLEEAFAFGAEGLVVPIVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatttatttgtaaccgattacaaaaaagtcattattagatggaggactgatatg
aaagccgtagttgttaatcaagctagtacaggtgtcgaagttgttgagcatgatcttcca
aatgttggtcatggtaaagcgcttgttaaagtagaatactgtggcgtttgtcatactgat
ttacacgttgcacatggcgattttggtcaggtaccaggacgtattttggggcacgaaggt
attggtatagtagaagaaattggagaaggcgtaacatccttaaaggttggtgatcgtgtc
tctattgcatggttctttgaaggatgtggtcattgcgaatactgtactacaggacgtgag
acactttgtcgtagtgttaaaaatgctggatacagtgttgatggaggaatgagtgaatat
gcagtagtaacagctgattatgcagttaaagttccagaaggtttagacccggctcaagct
tcttccattacttgtggtggtgtaccaacttataaagctattaaagaggcaggtgctgct
ccaggccaatggattgttatctttggggcaggtggccttggaaatctggctgttcaatac
gctaaaaaagtctttaatgcacatgttgtcgcagtggacattaataatgataaacttgag
ttagctaaagaagttggcgcagatattgtagttaacggcaaagaaattgaagatgttcca
ggctatattcaagaaaaaaccggtggagcacatggtgttgtggtaacggctgtttctaaa
gttgcttttaaccaagcaattgatagtgtccgtgccggtgggacagttgtagccgtaggt
cttccatcagaatacatggaactgtctatcgtaaaaactgttttagatggtatcaaagtg
gtcggatcacttgtagggacacgtaaagacttggaagaagcctttgcctttggtgcagaa
ggtctggttgttccgattgtcgaaaaagttccagttgacactgctccagaagtctttgat
gaaatggaacgtggtttaatccaagggcgcaaggtcttagatttcatcagctaa

DBGET integrated database retrieval system