KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0074Help
Entry
MGAS9429_Spy0074  CDS       T00358                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:spk00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86760..86864
Genome map
AA seq 34 aa AA seqDB search
MVMMSIDLCDYVTVDHIDDNKIVFASNCPKIPIN
NT seq 105 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgatgagtattgatctgtgtgactatgtgacggttgaccatatagatgacaat
aagattgtctttgcctcaaactgtccgaaaatacctattaactaa

DBGET integrated database retrieval system