KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0194Help
Entry
MGAS9429_Spy0194  CDS       T00358                                 

Gene name
hasC2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MGAS9429_Spy0194 (hasC2)
   00052 Galactose metabolism
    MGAS9429_Spy0194 (hasC2)
   00500 Starch and sucrose metabolism
    MGAS9429_Spy0194 (hasC2)
   00520 Amino sugar and nucleotide sugar metabolism
    MGAS9429_Spy0194 (hasC2)
Enzymes [BR:spk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MGAS9429_Spy0194 (hasC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(204886..205791)
Genome map
AA seq 301 aa AA seqDB search
MLMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTG
KSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKT
FVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAP
QAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAI
DTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYIIQLGKALEKTK
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatgaccaaagtcagaaaagctattattcccgcagcaggtttaggcacacgtttt
ttacctgcaaccaaggcccttgccaaggagatgctacctattgttgataaaccaactatt
caatttatcgttgaagaagctctaaaatcaggtatcgaagaaattcttatcgttactgga
aaatccaaacgctccatagaagatcattttgattctaattttgaattagaatataattta
caggctaaaggaaaaatcgaacttctaaagttagtagacgagaccacttctattaacctt
cactttattcgacagagtcatccaagaggattaggagacgcagttcttcaagcaaagacc
tttgttggcaatgaaccttttgttgtcatgctaggtgatgatctgatggatattacaaat
ccaaatgtaaaaccattaaccaaacaattgatcgatgactatgaagaaactcatgctgca
accattgccgtcatgagggttcctcacgaggatgtctctaactacggtatcattgctcct
caagcaaaagcagtaaaaggactctatagtgtggatacttttgttgaaaaaccacaacct
caagatgcacctagtgatttagcaattattggacgttacttgctcacaccagaaattttt
agtattttagaaaaacaagaacctggtgcaggcaatgaagttcaactgactgatgctatt
gataccctcaataagacacagcgtgtctttgctcgtgagtttaaagggaaacgctatgat
gttggcgataaatttgggtttatgaaaacttctttggattatgccctgaaacaccctcaa
gtcaaagatgacttgaaagcctacatcatccaactgggcaaagcactagagaagacaaaa
ccataa

DBGET integrated database retrieval system