KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0407Help
Entry
MGAS9429_Spy0407  CDS       T00358                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:spk03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
404062..404889
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRRGLETLVLGQEIVAVTLKVPKMVKTDLETFALTLPGQIIQSVGRRGKYL
LIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAK
SQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLW
AAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVY
GQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKRP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgaaacggtccgacgagggcttgagactttagtgcttggc
caagaaattgtggctgttacgcttaaagtaccaaaaatggttaaaaccgacttagagacg
tttgctctgaccctacctggtcaaatcattcagtcagttggccgtcggggaaaatattta
ttaattgatttggggcaattagtgttggtatcacatttgcggatggaaggcaaatatttg
ctttttccagatgaggtccctgataacaaacactttcatgtcttttttgaattgaaaaat
ggttcgaccttggtttaccaagatgtgcgtaaatttggaacctttgatttgatagcaaaa
tctcaattatcagcattttttgccaaacgaaaactaggccctgaaccaaagaaagagacc
tttaagttaaaaacctttgaggctgctctgctatcctcccaaaaacccataaaaccacat
ctgttagaccagaccttggttgctggtttagggaatatttatgtagacgaggtactttgg
gctgctaaggttcatccagaaactgcgtcttctaggttgaataaggcggagataaaacgg
ctgcatgatgaaaccatacgaatcctagctttaggaattgaaaagggcggttcgaccgtc
cgtacttaccgtaatgctttgggagctgatggcaccatgcaggactatttgcaggtttat
ggtcaaactgggaaaccgtgtcctcgttgtggacaggctattgtcaaattaaaagttgga
ggaagggggacgcacatttgtccaaaatgccagaaaaaaagaccatga

DBGET integrated database retrieval system