KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0493Help
Entry
MGAS9429_Spy0493  CDS       T00358                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spk00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MGAS9429_Spy0493
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MGAS9429_Spy0493
Enzymes [BR:spk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MGAS9429_Spy0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(485147..485671)
Genome map
AA seq 174 aa AA seqDB search
MIPLTKLSITPRRCHMPNLYDFTVKAQNGNDVSLAAYKKKVVLIVNTATKCGLTPQYQAL
QALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYHTTFPRFAKIKVNGKDADP
LFTWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgataccgttgaccaaattatcaattacaccgaggagatgtcacatgcctaatctctat
gattttacggttaaggctcaaaacgggaatgacgtttccttagctgcttataaaaaaaag
gttgttttgattgttaacacagctaccaagtgtggattaaccccacaataccaggccctg
caagcactatatgacacataccatgacaagggatttgaggtcttagattttccttgcaac
caatttttaaatcaagctccaggagatgctgaggagattaatcacttttgcagtctgacc
tatcacactactttccctcgctttgctaaaatcaaagtgaatggtaaagacgctgatcct
ttgttcacctggttaaaagaagaaaaaagtggtccccttgggaaacgcatcgaatggaat
ttcactaaatttctcattgaccaaaatggtcaagtcattaaacgctattcctcaaagaca
gatcctaaactaattgaagaagaccttaaagcacttcttggttaa

DBGET integrated database retrieval system