KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0499Help
Entry
MGAS9429_Spy0499  CDS       T00358                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
spk00010  Glycolysis / Gluconeogenesis
spk00051  Fructose and mannose metabolism
spk00562  Inositol phosphate metabolism
spk01100  Metabolic pathways
spk01110  Biosynthesis of secondary metabolites
spk01120  Microbial metabolism in diverse environments
spk01130  Biosynthesis of antibiotics
spk01200  Carbon metabolism
spk01230  Biosynthesis of amino acids
Module
spk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS9429_Spy0499 (tpi)
   00051 Fructose and mannose metabolism
    MGAS9429_Spy0499 (tpi)
   00562 Inositol phosphate metabolism
    MGAS9429_Spy0499 (tpi)
Enzymes [BR:spk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MGAS9429_Spy0499 (tpi)
Exosome [BR:spk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MGAS9429_Spy0499 (tpi)
  Exosomal proteins of bladder cancer cells
   MGAS9429_Spy0499 (tpi)
  Exosomal proteins of melanoma cells
   MGAS9429_Spy0499 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABF31687
UniProt: Q1JMR2
Position
493610..494368
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLVLAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
ADSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaaaaaccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattaccttcaactgaccttgttgatgttgcc
gtagcagccccagctgttgatttggtaaccactattgaagctgctaaagattcagttctt
aaagttgctgcacaaaactgctactttgaaaacacaggggcattcactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactatgttgtgattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaataaaaaagccaaagcaatctttgctaac
ggtttaactccaattgtttgttgtggtgagtctcttgaaacttatgaagctggtaaagcc
gttgagtttgtaggtgcgcaagtttcagcagcacttgcaggtctttcagcagagcaagta
gcttcacttgttttagcttatgagccaatctgggctatcggtactggtaaatcagctact
caagatgatgctcaaaacatgtgtaaagctgttcgtgatgtggtagcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgacggtgcccttgtaggtggtgcatcacttgaa
gctgatagctttcttgctttgcttgatttccttaactaa

DBGET integrated database retrieval system