KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0718Help
Entry
MGAS9429_Spy0718  CDS       T00358                                 

Gene name
mur1-1
Definition
N-acetylmuramidase (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Brite
Enzymes [BR:spk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     MGAS9429_Spy0718 (mur1-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
706964..707563
Genome map
AA seq 199 aa AA seqDB search
MKVKKRRRRARSSVNRLVLGLVLLNLIVSMWTLKLGNQRLAPYADHETLTFVRKISHAAQ
SVAQKKQLYSSVMMAQAILESNNGKSQLSQKPYYNFFGIKGSYKERSVIFPTLEDDGQGN
LYQIDAAFRSYGSLTACFLDYARVLNDPLYDKTHKKFWSHYQDATATLTGTYATDTTYHT
KLNELIEWYQLTNFDGLMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtgaaaaaaaggagaagaagggctagatcatcagtaaatcgacttgtcttaggg
ttagtattacttaatctgattgttagtatgtggacactaaaattgggaaaccagcgatta
gctccgtatgcggatcacgaaactctgacatttgtcaggaagattagtcatgctgctcaa
tcagtcgctcaaaagaaacagttatacagttcggtgatgatggctcaggccattttagaa
tccaataatggcaagtcacaactaagtcaaaaaccttattataattttttcgggattaag
gggagctataaagaacggtcagtcatttttccaactttagaagacgatggacaagggaat
ctttatcaaattgatgctgcttttcgttcctatgggagcctgacagcttgttttttagat
tacgcaagagttttgaatgatccactttatgacaaaacccacaaaaagttttggtctcat
tatcaagatgctactgcaaccttaacaggcacttacgccactgatacaacttaccatacc
aaattaaatgaattgattgaatggtatcaactcactaattttgatggtctaatgaaatag

DBGET integrated database retrieval system