KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0849Help
Entry
MGAS9429_Spy0849  CDS       T00358                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Brite
Enzymes [BR:spk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     MGAS9429_Spy0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
815587..816708
Genome map
AA seq 373 aa AA seqDB search
MQAGDVAIFMVVAGVTPYSHVAIFDSDAGSGYGWFLGQNQGGANGAYNLVKIPYSTTYPT
AFRPKVFKNAVTVIGNIGLNKGDYFIDVSAYQQADLTATCQQAGTTKTIIKVSESLAWLS
DRHQQQANTSDPIGYYHFGRFGGDSNLAQREADLFLSNLPTKKVSYLVIDYEDSASADKE
ANTNAVIAFMDKIANAGYKPVYYSYKPFTLNNIDYQQIIAKYPNSIWIAGYPDYEVRTEP
LWEFFPSMDGVRWWQFTSVGVAGGLDKNIVLLADDSSKVDIPKIDKPQSQLTFNQKLDTN
TKLDNSNVPYYEATLRTDYYVESKPNASSADKEFIKAGTRVRVYEKVNGWSRINASQSDQ
WVEDKYLSNATQV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctggagatgtcgcaatttttatggtagttgcaggtgttacaccgtatagccat
gtggctatttttgatagtgatgcaggtagtggatacggatggtttttaggtcaaaaccag
ggtggagcaaacggagcatataatttagtaaaaataccatattcaacgacttatcctact
gcatttagaccaaaagtttttaaaaatgcagttactgttataggtaatataggactaaat
aaaggcgattattttattgatgtatcagcttatcaacaagcagacttaaccgctacttgt
cagcaagctggcactactaaaacgattatcaaagtatccgagtcactcgcttggctgtct
gataggcatcagcaacaagctaatactagtgaccctattggttattatcactttggacga
tttggaggagatagcaacttagcgcaacgagaagcagatttatttctgtccaatttacca
accaaaaaagtctcttacttagtcattgattatgaagactctgcaagtgccgacaaagaa
gctaacactaatgcagttattgcgtttatggataaaattgcaaacgctggatataagcct
gtttattacagctataaaccatttacgcttaataatattgattatcagcaaattatcgct
aagtacccaaacagcatttggatagctggttatccagactacgaagtacgaacagagcca
ctttgggagttcttcccttcaatggatggtgtgcgctggtggcagttcacaagtgtagga
gtagcaggtggtttagataaaaatattgtattattagcagatgatagtagcaaagtggat
atacctaagattgacaaaccacaaagccagcttacttttaatcaaaagctagatactaac
actaaattagacaactcgaatgtaccttactacgaagcaacccttagaacagactattat
gtagagtctaagccaaacgcaagtagcgctgataaagaatttatcaaggcaggaactcgt
gtaagagtctatgaaaaagtgaatggatggtcacgtattaacgcttctcagtctgaccag
tgggtcgaagataagtatttatctaatgcaacacaagtataa

DBGET integrated database retrieval system