KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0940Help
Entry
MGAS9429_Spy0940  CDS       T00358                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGAS9429_Spy0940 (folE)
Enzymes [BR:spk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MGAS9429_Spy0940 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
900320..900928
Genome map
AA seq 202 aa AA seqDB search
MKRKRKKLMKRERLMSINKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGL
GKDPKEEFTAVFKEQHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLA
RAVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTT
ARGLYKESRAERQEVISLMTKD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaaaggaaaaaactaatgaaaagggaaagactaatgtctattaataaggaa
aaagcagaagcagccatttatcagtttttagaggctattggtgaaaatccaaatcgggaa
ggtcttcttgacacgcctaaacgggttgctaaaatgtatgcggagatgtttttgggactg
ggaaaagatcctaaagaggagtttacggctgtctttaaagaacaacatgaggatgtggtg
attgtcaaagacattagtttttattctatatgtgaacaccacttagttcctttttatggc
aaggctcatatcgcttacttgccaagtgatggtcgagtaacaggtttgagtaaattagcg
cgagcagttgaagtagctagtaaacgacctcaactccaagagcgtttgacctctcaaata
gcggatgctttagttgaagccctcaatcctaaagggactttagttatggtagaagcagag
cacatgtgcatgaccatgcgaggcatcaaaaagccaggtagtaaaaccattaccaccact
gccagaggcttatataaggaaagtcgtgctgagaggcaagaagttatttctctaatgaca
aaagattag

DBGET integrated database retrieval system