KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0941Help
Entry
MGAS9429_Spy0941  CDS       T00358                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
900937..901737
Genome map
AA seq 266 aa AA seqDB search
MKIGKFVIEGNAAIMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTR
PGCQFVSATDEIDRVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYD
GQMFALAAEYDAPIILMHNQDEEVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWVDPGFG
FAKSVQQNTELLKGLDRVCHLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAYAL
GKGCQIVRVHDVKANQDIVAVLSQLM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaaagtttgtgattgagggcaatgcggctatcatggggattttaaatgtg
actccagattctttttcagatggggggtcttacactactgtgcaaaaagcattagatcac
gttgagcaaatgattgctgatggggctaaaatcatcgacgttggtggagaatcaacacgt
ccaggttgccaatttgtaagcgctaccgatgaaattgaccgggtggttcctgtgatcaag
gccatcaaagaaaactatgatattctaatcagcattgatacctataaaaccgaaacagct
agagcagctttagaggcgggtgccgatattctcaatgatgtttgggcaggtttgtacgac
ggtcaaatgtttgccttagcagccgagtacgatgcgcctatcatcttgatgcataaccaa
gacgaagaagtttatcaagaggtaacacaagacgtttgtgattttctaggcaatagagca
caagcagctcttgatgctggcgtgccaaaaaacaatatttgggttgatccaggatttgga
tttgccaaatctgttcaacagaatacggagttattaaaaggattggaccgcgtctgtcat
ttgggctatcctgtcttgtttggtatttcgagaaagcgtgtcgtagatgccttgttaggc
ggcaacaccaaagctaaagagcgagacggagcgacagcagccttgtctgcttatgccctt
ggaaaaggctgtcagattgtacgcgtacacgatgtcaaggctaatcaagacattgtggct
gtgttgagccagttgatgtga

DBGET integrated database retrieval system