KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy0953Help
Entry
MGAS9429_Spy0953  CDS       T00358                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:spk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MGAS9429_Spy0953
Enzymes [BR:spk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     MGAS9429_Spy0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(912468..913559)
Genome map
AA seq 363 aa AA seqDB search
MNWLITSQPYKELNMKAATYLSTGNLQLIDKPKPVIIKPTDAIVQLVKTTICGTDLHILG
GDVPACKEGTILGHEGIGIVKEVGDAVTNFKIGDKVIISCVTSCHTCYYCKRGLSSHCED
GGWILGHLINGTQAEYVHIPHADGSLYHAPDTIDDEALVMLSDILPTSYEIGVLPSHVKP
GDNVCIVGAGPVGLAALLTVQFFSPANIIMVDLSQNRLEAAKTFGATHTICSGSSEEVKA
IIDDITNGRGVDISMECVGYPATFDICQKIISVGGHIANVGVHGKPVDFNLDELWIKNIT
LNTGLVNANTTEMLLNVLKTGKIDATRLITHHFKLSEVEKAYETFKHAGANNALKVIIDN
DIS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaattggttgattacctctcaaccttataaggagttaaatatgaaagcagcaacttat
ctttcaaccggaaatctacagctcatagacaaaccaaaaccagtcattataaagcctaca
gatgctatcgtccagttggtaaaaaccactatttgtggaactgatttgcatatcttaggt
ggggatgttcccgcatgtaaagaaggaacaatccttggtcatgaaggaattggaattgtt
aaggaggtcggtgatgcggttactaactttaaaatcggagataaagtgattatttcttgc
gtcacatcatgtcatacctgttattattgtaaacgaggcctttcgtcacattgtgaagat
ggcggttggattcttggccatttaattaatggaacacaagcagaatatgtccatatccca
catgcagatggtagtctctatcatgctcctgatacgattgatgatgaggcacttgtcatg
ctttctgatattttaccaacttcatatgaaattggtgtcttgccatcacatgtcaagcct
ggagataatgtttgtattgttggtgccggtccagtaggactcgcagccctactaaccgtt
caatttttctctccagccaatattattatggtcgacttatctcaaaatcgccttgaagca
gctaaaacatttggagccacacacacgatttgttcaggaagtagtgaagaagtcaaggct
atcattgacgatataaccaatggacgtggtgtcgatatttccatggagtgtgttggttat
cccgcgacatttgatatttgtcaaaaaattatatcagtaggtgggcatattgctaacgtt
ggggttcatgggaaaccagttgatttcaacctggatgaattatggattaaaaatatcacc
ttaaacactggacttgttaatgccaatacaactgaaatgctactaaatgtcttgaaaact
ggaaagattgacgcaacaagacttattacacatcattttaaactttcagaagttgaaaaa
gcttatgaaacctttaaacatgctggtgcaaataacgccttgaaagttattattgataat
gatattagctaa

DBGET integrated database retrieval system