KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy1369Help
Entry
MGAS9429_Spy1369  CDS       T00358                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MGAS9429_Spy1369
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MGAS9429_Spy1369
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MGAS9429_Spy1369
Enzymes [BR:spk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MGAS9429_Spy1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1335789..1336616)
Genome map
AA seq 275 aa AA seqDB search
MGMMKRQFEDVTRIVIKIGTSSLVLPTGKINLEKIDQLAFVISSLMNKGKEVILVSSGAM
GFGLDILKMEKRPTNLAKQQAVSSVGQVAMMSLYSQIFAHYQTNVSQILLTRDVVVFPES
LANVTNAFESLISLGIVPIVNENDAVSVDEMDHATKFGDNDRLSAVVAGITKADLLIMLS
DIDGLFDKNPTIYEDAQLRSHVAVITQEIIASAGGAGSKFGTGGMLSKIQSAQMVFENKG
QMVLMNGANPRDILRVLEGQPLGTWFKQIEEVTHD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgggtatgatgaaacgacaatttgaagatgtaacacgtatcgtaattaaaattggcact
agttcattagtgctaccaacaggtaaaatcaatttggaaaaaatcgaccaactggctttt
gtgatttcaagtttgatgaataagggcaaggaagttattttagtatcatcgggagcgatg
ggatttggactagatattttgaaaatggaaaaacgtccgaccaatcttgctaaacaacag
gcagtttccagtgttggtcaggtggccatgatgagtctttattcacaaatttttgcacac
taccaaaccaacgtgtcacaaattttattgacgagagatgtggtggttttcccagaaagt
ctagccaatgttaccaatgcttttgaaagtctgattagtttgggcattgtgccgattgtt
aatgaaaacgatgcggttagtgtggatgaaatggatcatgcgactaaatttggagataat
gaccgtttatctgctgtcgttgctggtattacaaaagctgatttattaatcatgttgtct
gatattgatggcctttttgataaaaaccctactatttatgaggatgcgcagttacgcagt
catgttgcagtcattacgcaagaaatcattgcgtcagcaggtggtgcgggcagtaaattt
ggcacaggtgggatgcttagcaaaattcagtctgctcagatggtatttgaaaacaaagga
cagatggtcttgatgaatggagctaatcccagagatattttaagagtgcttgaagggcaa
ccactaggcacctggttcaagcagatagaagaggtaacacatgactga

DBGET integrated database retrieval system