KEGG   Streptococcus pyogenes MGAS9429 (serotype M12): MGAS9429_Spy1813Help
Entry
MGAS9429_Spy1813  CDS       T00358                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
spk  Streptococcus pyogenes MGAS9429 (serotype M12)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:spk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1768492..1769088)
Genome map
AA seq 198 aa AA seqDB search
MYDYIKGQLTKITAKYIVVETNGLGYIINVANPYSFTDSVNQLVTIYLHQVIREDAHLLF
GFHTEDEKDVFLKLISVSGIGPTTALAIVAVDDNEGLVNAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFVEAPQETGNTKARSNKAGNTQLDEAIEALLALGYKATELKKIRAFFEGT
SETAEQYIKSALKLLMKG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggtcaattgaccaaaattacggcaaaatacattgtcgttgaa
acaaatggactaggctatattatcaatgtagccaatccttatagctttacagatagtgtc
aaccaactggtaactatttacctgcatcaagtgattcgtgaggatgctcacttgttgttt
gggtttcatacggaagacgaaaaagatgtttttctgaaattaatttctgtatctggcatt
ggccccacaacagctcttgctattgtggcagttgatgataatgagggacttgtgaatgcc
attgataacagtgacattaagtacctaatgaaatttcctaaaattggtaaaaaaacagcg
cagcaaatggttcttgacttagctggcaaatttgtggaggctccacaagagactggtaat
accaaagcgcgcagcaataaagcaggcaatactcaactggacgaagcgattgaagccctc
cttgccctcggttataaggcaacggaattgaagaaaattcgtgccttctttgaaggaacc
tctgagacggcagagcaatacatcaaatcagcattgaaactgttaatgaaagggtag

DBGET integrated database retrieval system