KEGG   Shewanella pealeana: Spea_0018Help
Entry
Spea_0018         CDS       T00606                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
spl  Shewanella pealeana
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spea_0018 (fadB)
   01212 Fatty acid metabolism
    Spea_0018 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Spea_0018 (fadB)
   00650 Butanoate metabolism
    Spea_0018 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Spea_0018 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Spea_0018 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spea_0018 (fadB)
   00310 Lysine degradation
    Spea_0018 (fadB)
   00380 Tryptophan metabolism
    Spea_0018 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Spea_0018 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Spea_0018 (fadB)
   00281 Geraniol degradation
    Spea_0018 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Spea_0018 (fadB)
Enzymes [BR:spl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Spea_0018 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Spea_0018 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Spea_0018 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     Spea_0018 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(20191..22344)
Genome map
AA seq 717 aa AA seqDB search
MIYQSPTIEVELLEDNIAHLCFKAQGSVNKFDRETIDSLNAALDSIKQDSSIKALMLSSA
KDAFVVGADITEFLGLFAEEDTVLQSWLEQANVVFNKLEDLPFPTISAINGFALGAGCET
ILATDFRIADTTARIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITSGKDQRPEAALK
VGAIDAVVAPEQLKPAALKMLKDALIEKLDWQTRRAKKQAPLTLPKLEAMMSFATAKGMV
FKVAGKHYPAPMAVISVIEQAAQLDRAGALQVEHQAFIKLAKTEVAQALIGIFLNDQLVK
GKAKKAGKLAKKVNSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAAKLL
TAQVKRGRSTPAKMAAVLNNITPALDYAPVKDADVVVEAVVEHPKVKSMVLAEVEQHVSE
DAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKMPLVEVIRGENSSDETVASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADGADFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKTGKDAIDVMFEAERFGQKNSKGFYQYSVDRRGKP
KKDLDPTSYELLQAEFGEQKAFESDEIIARTMIPMIIETVRCLEEGIIASPAEADMGLVY
GLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDTMRELAANNGSYYQQA
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagccctacaattgaggttgagttactcgaagacaatatcgcccacctg
tgcttcaaggcacaaggctcggttaataagttcgacagagaaaccatcgactcattaaat
gctgcactcgacagcatcaaacaagattctagcatcaaagcacttatgttaagttcggcc
aaagacgctttcgtcgttggcgccgatatcactgagtttctaggattatttgctgaagag
gacacggtcttacagtcttggttagagcaagccaatgtggttttcaacaagctagaagat
ctacccttcccaacaatttcggcaattaatggttttgcactaggcgcaggctgcgaaacc
attctagctacagacttccgtatagcagacaccactgcccgcataggtctaccagagact
aagctgggaattattccaggctttggtggtacggtacgtttacctcgcgtgatcggtgcc
gacaacgcacttgaatggatcacatcgggtaaagaccaacgtccagaagcggcacttaaa
gtcggcgcgattgacgcagttgtagctccagagcaacttaaacctgcagcgttgaaaatg
ctaaaagatgccctaatagagaagctagattggcagactcgccgcgctaagaaacaggcg
ccgctaacactaccaaagcttgaagccatgatgtctttcgccacagctaaaggcatggtg
tttaaagtagctggtaaacactaccctgcaccaatggcagtaattagtgtcatcgaacaa
gccgctcagttagatcgtgctggtgcgcttcaagtggagcatcaagcgttcatcaagcta
gctaaaacagaagtcgcacaagcattgattggcatcttcctcaatgatcagctcgtaaag
ggtaaggctaagaaagcgggcaagttagctaagaaagttaactcagctgcagtacttggc
gcaggtatcatgggtggcggtatcgcttaccaaagtgccagcaaaggtacaccaattgta
atgaaggatatcgctcaacctgcattggatttaggtttgggcgaagccgctaagctgctt
acggcacaagttaagcgtggccgttcaacccctgctaagatggctgcagtactgaacaac
atcactccagcactggactatgccccagtaaaagatgctgacgtggtggttgaagccgtt
gtcgagcatccaaaagttaaatctatggtactggcggaagttgaacagcatgtcagtgaa
gatgccatcatcacctcaaacacttcgactatctctatcaacctactggctaagagcctt
aaaaagcctgagcgtttctgtggtatgcacttcttcaaccctgtgcacaagatgccgcta
gtcgaagtcattcgcggtgagaacagctcagatgaaaccgttgcctcagttgtggcttac
gccagcaagatgggtaagacacctatcgtagttaatgactgcccaggctttttcgttaac
cgtgtactcttcccgtactttgccggctttagtggcctgcttgccgatggcgccgatttt
gctgctatcgacaaagtgatggagaagcagtttggttggccaatgggccctgcttacctg
ctcgacgttgtcggccttgatactggccatcatgcacaagcagtaatggctgaaggcttc
ccagaccgtatggggaaaactggtaaagatgccatcgatgtgatgttcgaagctgagcgt
ttcggccagaagaacagtaaaggtttctatcagtactcagttgaccgtcgtggtaagcca
aagaaagatttagacccaaccagctatgagttactacaagctgagtttggtgaacagaaa
gcatttgaatcagatgagatcatcgctcgcactatgatccctatgattattgagacagta
cgctgtcttgaagaaggaattatcgcttcgcctgctgaagcggatatgggcctagtttac
ggccttggtttcccaccatttagaggcggcgtgttccgctacctagatactatgggcgtc
gctaactttgtcgcgcttgccgacaaatatgcacacctaggtggtctataccaagtgacc
gacactatgcgcgaacttgccgccaacaatggcagctactaccagcaggcttaa

DBGET integrated database retrieval system