KEGG   Shewanella pealeana: Spea_0094Help
Entry
Spea_0094         CDS       T00606                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
spl  Shewanella pealeana
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Spea_0094
Enzymes [BR:spl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Spea_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(103963..104937)
Genome map
AA seq 324 aa AA seqDB search
MSIATEPYMNTNTAVSFSSEHHLNSPEQKVFWQQVTQSSFKTRDDISLAYARITHPNSIG
TIVISSGRVESYLKYKELMFDLYQQGYSLFAIDHRGQGLSARTTANPHQGHIDKFQRYVD
DFAEFVTKIVKPHAMENYYLVGHSMGGAIGTLYLSQYPATFKAAVFSAPMYGIKLPLPKA
FIRGLASLLDSSKQPNYILGGKGYHAEPFEKNDLTHSKLRYDDYRELYRQQPQLQLGSPT
NHWLVESIDAAEQAVDAARNSTIPLLILQAEEDTIVANAAQNRAVNGQCRLIKIPYARHE
IFMERDKPRNLALNALCEFLKQIN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgctaccgagccctatatgaacaccaatactgctgttagcttttcatcagaa
catcatctcaacagtcctgaacaaaaggtgttttggcagcaagtgacgcaatcgagcttc
aagactcgtgatgacattagcttagcctacgcccgtatcactcatccaaatagtattggc
accatagtgatcagcagtgggcgagtcgaatcctatctaaaatacaaagaactgatgttt
gacctgtatcagcaaggctacagcttgtttgccatcgatcatcgtggccaagggttatcg
gcacgcacaaccgctaatcctcatcagggacatatcgacaagttccagcgatatgtcgac
gacttcgccgaatttgtcacgaaaatagtcaaaccgcatgcaatggaaaactactaccta
gttggccattcaatggggggcgcaatcggtacgctctatctaagtcagtacccggcaacc
tttaaggccgcggtgttttcggcgcctatgtatggcatcaagctaccccttcccaaagcc
tttatccgcggcctagcgtctttactcgatagcagcaaacagcctaactatatattgggt
ggcaaaggctaccatgcagagccgttcgagaagaacgacctgacccacagcaagctgcgc
tatgacgattatcgcgagctataccgccagcagccacagctgcagctaggttcgccaacc
aaccattggttagtcgagtccatcgatgctgccgagcaggcggtagatgccgctcgaaat
agtactatcccgctgctaatcttgcaggcagaagaagatactatcgtcgctaatgccgcg
cagaatcgcgccgtaaacggccagtgccgcttaattaaaatcccctatgcccgtcatgag
atctttatggagcgagacaagccgcgcaaccttgcgctcaacgcattatgcgagttctta
aagcaaattaactaa

DBGET integrated database retrieval system