KEGG   Shewanella pealeana: Spea_0372Help
Entry
Spea_0372         CDS       T00606                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
spl  Shewanella pealeana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Spea_0372
Enzymes [BR:spl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Spea_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(451380..452111)
Genome map
AA seq 243 aa AA seqDB search
MKILLTRPEGRNQLMKEALTQRNVSYFITPLLNVQPTSNLDANQIDKQLKLADIIIFIST
NAVAFASQAIDNQWPSSAQYFAVGDATHAALKQLGIDAQRAPEDCQQTEGLLTLTSLADV
TGKQIIIVRGQGGREDLATELIKRNAQLSYWEVYKRGCPALDSANLCQQWRSFGIDTIII
TSGEILDNLIKTVPKELFAWLQTCHIIVPSPRVYEKAKAYNLLHVSNATAANTNAMLAAL
SLN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttactgacgcgccctgaagggcgcaatcagttgatgaaagaggcgttgact
cagcgcaacgtctcttacttcatcacgcccctactcaacgttcagcccacttctaatctt
gatgctaatcaaatcgataagcagcttaagctagccgacattatcattttcatcagcacc
aatgccgttgcttttgcctcccaagcaatcgataaccaatggccgagttcagcgcaatac
ttcgccgttggcgatgccacccatgccgcgttgaaacagctcggtattgatgcccaaaga
gcaccagaagattgccaacaaactgaaggcttgcttaccctgacctcattagccgatgtc
actggcaaacagattattatcgttagaggtcaaggtggtcgggaagatctagccacagag
ctaatcaagcgaaatgctcagctcagctattgggaagtctataagcgcggctgcccagcg
cttgatagcgctaacctttgtcagcaatggcgaagctttggtatagacactattatcatt
accagtggcgaaatactcgataacctcattaaaacagtaccaaaagagctatttgcttgg
ctgcaaacttgtcatattatagtccctagcccccgagtatatgaaaaggcaaaggcttat
aatcttttgcatgtcagcaatgcgacagccgctaacaccaatgccatgttagcagcgtta
tctttaaactag

DBGET integrated database retrieval system