KEGG   Shewanella pealeana: Spea_0372Help
Entry
Spea_0372         CDS       T00606                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
spl  Shewanella pealeana
Pathway
spl00860  Porphyrin and chlorophyll metabolism
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
Module
spl_M00121  Heme biosynthesis, glutamate => heme
spl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Spea_0372
Enzymes [BR:spl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Spea_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABV85700
JGI: Spea0372
UniProt: A8GZG3
Position
complement(451380..452111)
Genome map
AA seq 243 aa AA seqDB search
MKILLTRPEGRNQLMKEALTQRNVSYFITPLLNVQPTSNLDANQIDKQLKLADIIIFIST
NAVAFASQAIDNQWPSSAQYFAVGDATHAALKQLGIDAQRAPEDCQQTEGLLTLTSLADV
TGKQIIIVRGQGGREDLATELIKRNAQLSYWEVYKRGCPALDSANLCQQWRSFGIDTIII
TSGEILDNLIKTVPKELFAWLQTCHIIVPSPRVYEKAKAYNLLHVSNATAANTNAMLAAL
SLN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttactgacgcgccctgaagggcgcaatcagttgatgaaagaggcgttgact
cagcgcaacgtctcttacttcatcacgcccctactcaacgttcagcccacttctaatctt
gatgctaatcaaatcgataagcagcttaagctagccgacattatcattttcatcagcacc
aatgccgttgcttttgcctcccaagcaatcgataaccaatggccgagttcagcgcaatac
ttcgccgttggcgatgccacccatgccgcgttgaaacagctcggtattgatgcccaaaga
gcaccagaagattgccaacaaactgaaggcttgcttaccctgacctcattagccgatgtc
actggcaaacagattattatcgttagaggtcaaggtggtcgggaagatctagccacagag
ctaatcaagcgaaatgctcagctcagctattgggaagtctataagcgcggctgcccagcg
cttgatagcgctaacctttgtcagcaatggcgaagctttggtatagacactattatcatt
accagtggcgaaatactcgataacctcattaaaacagtaccaaaagagctatttgcttgg
ctgcaaacttgtcatattatagtccctagcccccgagtatatgaaaaggcaaaggcttat
aatcttttgcatgtcagcaatgcgacagccgctaacaccaatgccatgttagcagcgtta
tctttaaactag

DBGET integrated database retrieval system