KEGG   Shewanella pealeana: Spea_0420Help
Entry
Spea_0420         CDS       T00606                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spl  Shewanella pealeana
Pathway
spl00010  Glycolysis / Gluconeogenesis
spl00020  Citrate cycle (TCA cycle)
spl00620  Pyruvate metabolism
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
spl01130  Biosynthesis of antibiotics
spl01200  Carbon metabolism
Module
spl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spea_0420
   00020 Citrate cycle (TCA cycle)
    Spea_0420
   00620 Pyruvate metabolism
    Spea_0420
Enzymes [BR:spl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Spea_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N Biotin_lipoyl_2 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABV85748
JGI: Spea0420
UniProt: A8GZL1
Position
514693..516555
Genome map
AA seq 620 aa AA seqDB search
MTIEINVPDIGADEVEVTEILVSVGDKVEEEQSLISVEGDKAAMEVPASAAGIVKEIKVV
VGDKVSTDSLIMIFESEGAASAPAAVEAAPVAAPAAPAAAAAAELKEVHVPDIGDDEVEV
TEILVTVGDSITEEQSLMSVEGDKASMEVPAPFAGVLKEIKVNLGDKVSTGSLVMVFEVA
GSAAAQAPAAAAVAAQVASAPSVQDVNVPDIGGDEVEVTEIMVKVGDTVTEEQSLISVEG
DKAAMEVPAPFAGKVLDIKVAQGDKVSTGSLIMTFEVAGSAPVAAPAQVAAPTVAPTASQ
APAAKEDFVENHAYAHASPVIRRMARELGVNLANVKGTGRKNRIIKEDVQNYIKAVIKQV
ESGAVKTAAAGGELNLLAWPKVDFSKFGETEVKPLSRIQKISGANLHRNWVKIPHVTQWD
DADITELEAFRKAQNAAEAKKDSGMKITPLVFIMKAVAKALEAFPTFNSSLSEDGESLIL
KKYVNVGIAVDTPNGLVVPVFKDVNKKGIHELSDELKEISKKARGGKLTAADMQGGCFTI
SSLGGIGGTAFTPIVNAPEVAILGVSKSDMKPVWNGKEFEPRLMLPLSLSYDHRVIDGAD
GARFITYLNNCLSDIRTLVL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattaatgtaccagatatcggtgcggatgaggttgaagtaacagagatc
cttgttagcgtaggcgacaaggttgaagaagagcaatcgcttatctctgttgaaggcgat
aaagctgcgatggaagttccggcttctgcagcgggtattgttaaagaaattaaagtagta
gtaggtgataaagtgtctaccgattcattgattatgatctttgaatctgaaggcgcagcg
tctgctccagcagctgtcgaggctgcacctgttgcggctcctgctgcaccagctgcggca
gctgcggcagagctaaaagaagttcacgtcccagatattggtgacgacgaagttgaagtg
actgaaattttagtgactgttggcgacagcatcactgaagagcaatcgctaatgagcgtt
gaaggtgacaaagcttctatggaagtacctgcaccattcgctggtgtgctgaaagagata
aaagtgaaccttggtgacaaggtttctacaggtagcctagtgatggtatttgaagtagct
ggttctgcagcggctcaagcacctgctgcggcagccgttgctgctcaagtagcatctgcg
ccatcagtgcaagatgtcaacgtaccagatattggcggtgatgaagttgaagtgactgaa
atcatggttaaagttggcgacactgttaccgaagagcaatcacttatcagcgttgaaggt
gataaggctgcgatggaagtgcctgcaccgtttgctggtaaagtgttagacattaaagtg
gctcaaggcgataaagtatcgacaggctctttgattatgacttttgaagttgcaggtagc
gcacctgttgctgcacctgcacaagttgcagcgccaacagttgctcctactgcgagccaa
gcaccagcagcgaaagaagattttgtagagaatcatgcatacgctcatgcttcaccggtt
atccgccgtatggcacgtgaactaggcgttaacctagctaacgttaagggtacaggtcgt
aagaaccgtatcattaaagaagatgttcaaaactacatcaaagcggtgattaagcaagtt
gagtcaggcgcagttaaaacagccgctgctggtggcgagctaaacctacttgcatggcca
aaagtggacttcagcaagtttggtgaaacagaagttaaaccgttatcacgtattcagaag
atttctggtgctaatctacaccgtaactgggtgaagatcccgcatgttacccagtgggat
gacgcagatatcactgaactagaagctttccgtaaggcgcaaaatgctgccgaagcgaag
aaagactctggcatgaagattacgccgcttgtgttcatcatgaaggctgttgctaaagcg
ctagaagcgttcccaacctttaactcttcactgtcagaagacggcgaaagcttaattttg
aagaagtacgttaacgtaggtattgcagtagatacaccaaacggtttagttgttcctgtg
tttaaagacgtgaacaagaaaggcattcatgagctttctgatgagctgaaagagatctct
aagaaagcccgtggtggtaagttaactgctgcagatatgcaaggcggttgcttcactatc
tctagcttaggtggcatcggcggtacggcatttacgccaatcgttaacgcaccagaagtg
gctattcttggtgtgtctaagtcagacatgaagcctgtttggaatggtaaagagtttgag
ccgcgcttaatgttgccgctatcactgtcttatgatcatcgagtgattgatggtgccgat
ggtgcgcgctttatcacgtacttgaataactgcttgtcagacattcgtaccttagtgcta
taa

DBGET integrated database retrieval system