KEGG   Shewanella pealeana: Spea_0420Help
Entry
Spea_0420         CDS       T00606                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spl  Shewanella pealeana
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:spl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:spl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:spl00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
514693..516555
Genome map
AA seq 620 aa AA seqDB search
MTIEINVPDIGADEVEVTEILVSVGDKVEEEQSLISVEGDKAAMEVPASAAGIVKEIKVV
VGDKVSTDSLIMIFESEGAASAPAAVEAAPVAAPAAPAAAAAAELKEVHVPDIGDDEVEV
TEILVTVGDSITEEQSLMSVEGDKASMEVPAPFAGVLKEIKVNLGDKVSTGSLVMVFEVA
GSAAAQAPAAAAVAAQVASAPSVQDVNVPDIGGDEVEVTEIMVKVGDTVTEEQSLISVEG
DKAAMEVPAPFAGKVLDIKVAQGDKVSTGSLIMTFEVAGSAPVAAPAQVAAPTVAPTASQ
APAAKEDFVENHAYAHASPVIRRMARELGVNLANVKGTGRKNRIIKEDVQNYIKAVIKQV
ESGAVKTAAAGGELNLLAWPKVDFSKFGETEVKPLSRIQKISGANLHRNWVKIPHVTQWD
DADITELEAFRKAQNAAEAKKDSGMKITPLVFIMKAVAKALEAFPTFNSSLSEDGESLIL
KKYVNVGIAVDTPNGLVVPVFKDVNKKGIHELSDELKEISKKARGGKLTAADMQGGCFTI
SSLGGIGGTAFTPIVNAPEVAILGVSKSDMKPVWNGKEFEPRLMLPLSLSYDHRVIDGAD
GARFITYLNNCLSDIRTLVL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattaatgtaccagatatcggtgcggatgaggttgaagtaacagagatc
cttgttagcgtaggcgacaaggttgaagaagagcaatcgcttatctctgttgaaggcgat
aaagctgcgatggaagttccggcttctgcagcgggtattgttaaagaaattaaagtagta
gtaggtgataaagtgtctaccgattcattgattatgatctttgaatctgaaggcgcagcg
tctgctccagcagctgtcgaggctgcacctgttgcggctcctgctgcaccagctgcggca
gctgcggcagagctaaaagaagttcacgtcccagatattggtgacgacgaagttgaagtg
actgaaattttagtgactgttggcgacagcatcactgaagagcaatcgctaatgagcgtt
gaaggtgacaaagcttctatggaagtacctgcaccattcgctggtgtgctgaaagagata
aaagtgaaccttggtgacaaggtttctacaggtagcctagtgatggtatttgaagtagct
ggttctgcagcggctcaagcacctgctgcggcagccgttgctgctcaagtagcatctgcg
ccatcagtgcaagatgtcaacgtaccagatattggcggtgatgaagttgaagtgactgaa
atcatggttaaagttggcgacactgttaccgaagagcaatcacttatcagcgttgaaggt
gataaggctgcgatggaagtgcctgcaccgtttgctggtaaagtgttagacattaaagtg
gctcaaggcgataaagtatcgacaggctctttgattatgacttttgaagttgcaggtagc
gcacctgttgctgcacctgcacaagttgcagcgccaacagttgctcctactgcgagccaa
gcaccagcagcgaaagaagattttgtagagaatcatgcatacgctcatgcttcaccggtt
atccgccgtatggcacgtgaactaggcgttaacctagctaacgttaagggtacaggtcgt
aagaaccgtatcattaaagaagatgttcaaaactacatcaaagcggtgattaagcaagtt
gagtcaggcgcagttaaaacagccgctgctggtggcgagctaaacctacttgcatggcca
aaagtggacttcagcaagtttggtgaaacagaagttaaaccgttatcacgtattcagaag
atttctggtgctaatctacaccgtaactgggtgaagatcccgcatgttacccagtgggat
gacgcagatatcactgaactagaagctttccgtaaggcgcaaaatgctgccgaagcgaag
aaagactctggcatgaagattacgccgcttgtgttcatcatgaaggctgttgctaaagcg
ctagaagcgttcccaacctttaactcttcactgtcagaagacggcgaaagcttaattttg
aagaagtacgttaacgtaggtattgcagtagatacaccaaacggtttagttgttcctgtg
tttaaagacgtgaacaagaaaggcattcatgagctttctgatgagctgaaagagatctct
aagaaagcccgtggtggtaagttaactgctgcagatatgcaaggcggttgcttcactatc
tctagcttaggtggcatcggcggtacggcatttacgccaatcgttaacgcaccagaagtg
gctattcttggtgtgtctaagtcagacatgaagcctgtttggaatggtaaagagtttgag
ccgcgcttaatgttgccgctatcactgtcttatgatcatcgagtgattgatggtgccgat
ggtgcgcgctttatcacgtacttgaataactgcttgtcagacattcgtaccttagtgcta
taa

DBGET integrated database retrieval system