KEGG   Shewanella pealeana: Spea_0518Help
Entry
Spea_0518         CDS       T00606                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
spl  Shewanella pealeana
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Spea_0518
Enzymes [BR:spl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Spea_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
632466..633389
Genome map
AA seq 307 aa AA seqDB search
MKMSQLIVLGSVNADHVLQVPSFPRPGETLHGHNYQVIPGGKGANQAVAAARLGGDIGFI
ACVGDDSFGQNIRQTFTNDGMDISAVHMIENTPTGIAMIQVSDCGENSICIAAEANNALT
AEIVEQHSAMIEQAEYLLMQLETPLAGIELAASIAKVHGTQVVLNPAPARSLPDALLAMV
DIITPNETEAEVLTGVAVTDADSAAKAAQVLHDKGIATVMITLGAKGVYLSEQDTGKIIP
GFKVKATDTTAAGDTFNGAFVTGLLEGKAIENAIVFAHGAAAISVTRFGAQTSIPSRDEV
EQFIAAQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtctcagttaatcgttttaggcagtgtgaatgccgaccatgttcttcaagtg
ccttctttcccacgtccaggcgaaaccctgcatggccataactaccaagtgatccctggt
ggtaaaggggctaatcaagcggtagctgctgctcgccttggtggcgatattggttttatc
gcttgcgtaggtgatgatagctttggtcaaaatattcgccagacttttacaaatgatggc
atggatatttcagcagtacacatgattgagaataccccaacgggtattgcgatgatccag
gtgagtgattgcggtgaaaacagcatctgtatcgccgctgaggcaaataatgcattaaca
gctgagattgttgagcagcattcggcaatgattgagcaagccgaatatctattgatgcaa
ctagaaacaccattagcgggcattgaactggcggcgagcattgctaaagtgcatggcact
caggtggtattaaacccagcgcctgcgcgtagcctacctgatgcactcttggctatggtt
gatatcattacccctaacgagactgaagccgaagtgctaacaggcgtagccgtgactgat
gccgatagcgcagctaaagccgctcaagtgctgcacgacaaaggcatagcgacagtgatg
atcactctaggcgcaaaaggtgtgtacttaagtgagcaagacacgggtaaaattatccca
ggatttaaggtaaaagccaccgataccactgctgcaggggacacctttaacggcgcattt
gtgactggattactcgaaggtaaagctatcgaaaatgcaatcgtgtttgcccatggcgca
gcggctatttcggtaacccgttttggtgcacaaacctcaattccatcacgagatgaagtt
gagcagtttattgcggcgcagtaa

DBGET integrated database retrieval system