KEGG   Shewanella pealeana: Spea_0580Help
Entry
Spea_0580         CDS       T00606                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
spl  Shewanella pealeana
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spl00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:spl00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:spl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(709947..713180)
Genome map
AA seq 1077 aa AA seqDB search
MKSHALMNTRQLTSKNVTSCRLIASVVALLVCPLSFASDAPLRWQNHQIFEQNKQPPHAS
FFGYSSQEKALTDEYRDSENFFDLNGRWQFHYANNPSSAPKDFAQVEANLADWQSIQVPG
NWETQGFGHAIYLDERYPFSTTWPDAPEDHNPTGSYRREINLPQSWQDKQVFLHIGAARS
ALTAFVNGQEVGYSQGAKTPAEFDITPYLNQEQNLLALQIIRWSDASYLESQDMLRVSGI
ERDVYLYATEKQRISDIDAQYQMSANLDKAEVALKLKLENHAKAKDVSLSYRLLSPQGVE
VSRGEQKIAKLAKQDTRQFDFPLNSPMLWSAETPNLYQLIVSLNDNQGELLQASSQHLGF
RRVEINNGQLLVNNKAITIRGVDRHETDPDTGHVVSRASMETDIRLMKQNNINAVRSSHY
PNDPYWLSLTDKYGLYVIDEANIESHPLAIDKNTQLGNEMSWLPAHQARVERMVERDKNH
PSIIIWSLGNEAGEGKLFAALYDWIKQRDPSRPVQYEPAGQHAYTDIVAPMYPSIERIEK
YAKEHQDRPLIMIEYAHAMGNSVGNLQDYWDVIEQYPQLQGGFIWDWVDQSLAFTNENGQ
RYWAYGKDYHPDMPTDGNFLNNGLVDPDRNPHPHLSEVKKVYQPLKLTELTRNQQDVTFT
LSNRYDFIDTLGLNLIWTLQQDGRPVAEGLVAMPQVKADTSQVLNFTLPESAIKTMQQSP
QYEYQLLLEVKVDTPQPMLPSDHLIAFEQFALQSAKPVTAKTIDAIKETRDSWILGKNNA
QYLFNKDTGWLTDIRVEGESQLKSPLIANFWRAPTDNDLGNQMPKWAGMWQDAGQELELV
SITRSKGQHAALKVTHQHPKLGFTLTSSYRVSDQAKLLVSSDFTPGDGELADLPRFGFSA
RLPFEVRFMHYFGRGPEETYTDRKTGNPVAWYALPIEQTFHRYSRPQETGQRTDVRYVAV
TNNKGAGLLAQTTMNSEMLQTSLWPFAQADIDFRDGDAEGSASGLVPVTANHGAEIPIRD
FVTWNIDYKQMGVGGDTSWGRPVHAPYRIAPKAMSFSFSLEPISANTDIKKQARGLQ
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtcatgccctgatgaatacccgacaattaaccagcaaaaatgtaacctcctgc
cgccttatcgccagtgtagttgcccttttagtctgccctctgagctttgctagtgatgcg
cctctaagatggcagaaccaccaaatcttcgagcagaacaagcagccaccccatgcgagc
ttctttggctattccagccaagaaaaagccctcactgatgagtatagagacagtgaaaac
ttcttcgatcttaacggtcgctggcagtttcattatgcgaacaatccatcgagcgcccca
aaggattttgcgcaagtagaggccaaccttgctgactggcagagcattcaagttcccggc
aattgggaaacacaaggttttggccacgccatctatttagatgagcgctacccatttagc
accacctggcccgatgcccctgaagatcacaacccgacgggtagttaccgccgtgagata
aatctgccgcagagttggcaagacaagcaggtatttctgcacattggcgccgcacgctcg
gcgctgaccgccttcgttaatggccaggaggtcggttatagtcagggcgctaagacccct
gcagaatttgatattaccccttatctaaatcaagaacagaatctactggccttacagatt
attcgctggagtgatgccagttatttagaaagccaagacatgcttagggtcagtggcatc
gagcgcgatgtctatctgtatgctactgagaaacagcgtattagcgatatcgacgcccaa
tatcagatgtcggcaaacttagataaggctgaagttgcacttaaactgaagttagaaaac
catgccaaagctaaagatgtgagccttagctatcgactgctatcgcctcaaggtgtagag
gttagccgcggtgaacagaaaatagctaaactggcaaagcaagatacacggcagttcgat
tttcctctcaattctcctatgctttggagcgcagaaactcccaacctctatcaactaatt
gtcagccttaacgataaccaaggtgaattgctacaagccagtagccaacatttgggcttt
cgccgagtcgagattaacaatggtcaactactggtcaataacaaggcgatcaccattcgt
ggcgtcgacaggcacgaaaccgatcccgatacaggccacgttgtcagtcgagccagtatg
gaaactgatatccgcctgatgaagcagaacaatatcaatgcggtgcgctcgagccattat
cccaatgatccttactggctgagcctcaccgataagtatggtctgtatgtaattgatgaa
gccaatatcgaatcacatccgctagctatcgataaaaatacccagcttggtaatgagatg
agctggttgccagcccatcaagcgcgagtcgaacgtatggtcgagcgcgataagaatcac
ccctctatcatcatctggtctctgggcaacgaagccggagaaggtaaactctttgccgcg
ctctatgattggattaagcagcgcgacccgagtcgccctgtacagtatgagcctgccggt
caacatgcttataccgatatcgtcgcccctatgtatccgtccattgagcgcatcgaaaag
tacgccaaagagcatcaggataggccacttattatgattgagtacgcccatgccatgggc
aactcggtcggtaatctgcaagattactgggatgtcatcgaacaataccctcagcttcaa
ggcggctttatttgggactgggtcgaccaatccctcgcctttaccaatgaaaatggtcag
cgctattgggcctacggtaaagactatcatcctgatatgcctaccgatggtaactttcta
aataatggtttagtggatcccgatagaaacccgcacccacatctatctgaggtgaagaag
gtttatcagccgctcaagctaactgaactaacccgaaaccagcaagatgtgacgtttacc
ttaagcaaccgctatgactttatcgacaccttagggctaaacctaatatggacattgcaa
caagacggacgtccggttgccgaaggcttggtcgcgatgccacaagtaaaggcggataca
agccaagtgctcaactttaccttgcctgagtctgcgattaagactatgcagcaaagcccg
caatatgagtatcaactgctattagaggtcaaggtcgatacccctcagcctatgttacca
agcgatcacctaatagccttcgagcaattcgccctgcaatcagctaagcctgtaacggca
aagaccatcgatgcgataaaggagacccgtgatagctggatattagggaaaaataacgcc
cagtatctgttcaacaaagacacaggctggttaactgacattcgagtcgaaggagagtct
caactcaagagcccgttaatagccaacttttggcgcgcccctaccgataacgacttaggt
aaccagatgcctaagtgggcaggtatgtggcaagacgcagggcaagaacttgaactcgtc
tccatcactcgcagcaaaggccagcatgcggcgcttaaggttacccaccagcaccctaag
cttggctttacgcttacctcctcttatcgagtgagcgatcaggccaaactgttagtcagc
agtgactttacccctggagatggtgaacttgccgatcttccccgcttcggtttttctgca
aggctccctttcgaggtgcgctttatgcactactttggccgcggccccgaagagacctat
accgatagaaaaaccggcaatcctgttgcctggtatgccctgccgatagagcaaaccttc
catcgctattcacgcccgcaggaaactgggcaacgcaccgatgtacgctatgtcgccgta
accaataacaagggagcaggcctacttgcgcaaaccaccatgaacagtgaaatgctgcaa
acgagtctgtggccatttgctcaagcagatatcgactttagggacggcgatgccgaaggt
tcagcatcagggctagtaccagtgacagcgaaccatggcgccgagatcccaatccgagat
tttgtcacctggaatatcgattacaaacagatgggcgtcggcggtgatacctcatggggg
cgtcctgtacacgcaccctatcgtatcgcaccaaaagcgatgagcttcagctttagccta
gagcccatttcagctaacacagatataaaaaagcaggctagaggcctgcaatag

DBGET integrated database retrieval system