KEGG   Shewanella pealeana: Spea_0661Help
Entry
Spea_0661         CDS       T00606                                 

Definition
phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
spl  Shewanella pealeana
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:spl00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:spl00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:spl00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:spl00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(819752..820717)
Genome map
AA seq 321 aa AA seqDB search
MNKLAARLLAIGLCCSFNLYAHSETQTNKGEESETEASDSEIEVKPKQEVSLVDKRILEE
SATDDLPYVITPHKVNYILPVTYSASPNMAPFAEEAAEHPFTLDNMEAKFQISFKFPLWH
NVFGDNGHLFAAYTNQSYWQVYNKEISSPFRETNHEPEIFMIFTNDWQLGPLKNSFWGFG
AVHQSNGQSGSRSRSWNRLYGTMVFDNGPFALEAKAWWRIPEDEKETPESPKGDDNPDIT
DYMGNLELTGVYGLGEHRFTLMVRNYIQKPNYGALEFTWSYPILGNLRLYTQYFNGYGES
LIDYNVHNQRIGIGVSINDIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattagctgcgcgactgttagccataggcttgtgctgctcttttaacctttat
gctcatagtgagacccaaactaacaagggtgaagaaagcgaaactgaagcgagtgattcc
gagattgaagtgaagcccaagcaagaggtgtctttggttgataaacggatcttggaagaa
agcgcaactgatgatctgccttatgtcatcaccccccataaggtgaattatattctcccc
gtgacttacagtgcctcgcccaatatggcaccttttgcagaagaagcagccgagcatccg
tttaccttagataatatggaagccaagtttcaaatcagctttaagtttccactttggcat
aacgtctttggcgataatggccacttgtttgcggcctataccaatcagtcctattggcag
gtgtacaacaaagagatctcctcgccatttagagagactaaccatgagcccgagatcttt
atgatctttaccaacgactggcaacttggaccactgaaaaattcgttttggggttttggt
gccgtgcatcaatcaaacggtcagtctggctcgcgttcacgcagctggaaccgtttatac
ggcaccatggtatttgataacggccccttcgcactagaagctaaggcatggtggcgcata
cctgaagatgaaaaggaaacccctgagtcacccaaaggcgatgataaccctgatatcacc
gactatatgggcaatcttgaactcactggcgtatacggcttgggcgaacacaggttcacc
ctgatggttcgtaactatattcaaaagcctaactatggcgcacttgaattcacctggagc
tacccaatcttgggtaacttaaggctttatactcaatattttaatggctacggtgaaagt
ttaatcgactacaatgtacataatcagcgcataggtatcggggtttcgattaacgacatc
ttataa

DBGET integrated database retrieval system