KEGG   Shewanella pealeana: Spea_0806Help
Entry
Spea_0806         CDS       T00606                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
spl  Shewanella pealeana
Brite
Enzymes [BR:spl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Spea_0806
Secretion system [BR:spl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Spea_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
999232..999957
Genome map
AA seq 241 aa AA seqDB search
MKFTRTFSLIAAMMIAPAALAASNSSDDTAALKQKLSDALSVEVISIKPSPVAELYEAYT
DRGVLYISRDGSKLFHGSLYDLDKGMKNLTEAAMAGPRLDMLKPLEDNMLVYKAKNEKHV
VTIFTDVSCGYCRKLHNEMDGYNDLGITVRYLAFPRAGVPSANADEMESVWCAADPLKAM
GQAKNGKAIKQAKCDAKIAEQYNVGQAIGINGTPAIILEDGTLIPGYQPPKALLRTLESV
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcactcgaacattttctttgattgctgcgatgatgatagcaccagcagcccta
gctgcatcgaatagcagcgacgatactgccgcgttaaaacaaaagctaagtgacgcatta
agcgttgaagtgatctcaattaagccttcacccgttgcagagttatatgaagcctacaca
gatcgcggcgtgctttatatttctagagatggttcaaagctatttcacggtagcctttat
gacttagataaaggtatgaagaaccttactgaagccgctatggccggtcctcgtttggac
atgttgaagccacttgaagacaacatgttggtttacaaggccaagaatgaaaagcatgta
gtgactatctttaccgatgtcagctgcggttattgccgtaagttgcacaacgaaatggac
ggttataacgatctaggtattacagtgcgttaccttgccttcccgcgtgctggtgtgcca
tcggctaatgccgacgagatggagtctgtatggtgtgcagccgatccgctaaaggcgatg
ggccaagctaaaaatggtaaagcgattaagcaagctaagtgtgacgctaagattgctgag
caatataatgtaggtcaagctattggtattaacggtacaccggcaatcattcttgaagac
ggtactttgatccctggctaccagccacctaaggcactgttacgtacactcgagtcagta
cagtaa

DBGET integrated database retrieval system