KEGG   Shewanella pealeana: Spea_0820Help
Entry
Spea_0820         CDS       T00606                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
spl  Shewanella pealeana
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:spl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:spl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1016981..1018750
Genome map
AA seq 589 aa AA seqDB search
MKRPFTRRDFLAMSAKGVGAAVVSYGLMGCSSDDDDNNGIYAEFLHGLASGDPSHDAVIL
WTRVTPKRDGEIKVSWEVATDAAFTQLVSNGETMTSGDRDYTVKVDATGLEAGRQYFYRF
KTGNKTSQPAMTKTLPQGAIDSAKFAVVSCANFPAGYFNVYEMASRMDDLDAVIHLGDYI
YEYARGEYASERAEELGREVLPEGELMSLSDYRTRYGQYRSDISLQKLHGKTPFITVWDD
HEVANDSWRDGAENHNEGEGDFDARKEAALQAYFEWLPIRPWREGNHEEIYRSFNFGDLV
DLHMLDTRLLGRDKPLDYAEYMDPATGGLDSARFMADITDTNRTMLGQDQQAWLQTALLT
STATWQVLGQQVLMGQMMLPAAIATQQLSIPEFGQLAALAQFAARKAAGDPTLTADELKY
LSFYGHKLTPEAMALLQLPSIPYNLDSWDGYAYEREVILATAKSQTKNLVVIAGDTHNAW
ANELKDAAGDAVGVEFATSSVSSPGLEYYLGIEEKDIAATEAAIVDLVDNLAYTNLMNRG
LMTLTFTHEEVRTDWRYVDTIYSRDFTEDSERNFSMVTKAGSHGLIAAS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaccttttactcgaagagactttttggcaatgtcggcaaagggggttggcgct
gccgttgtatcctacggcctgatgggctgtagtagtgacgatgacgacaataatggcatt
tatgccgaattcctccacggccttgctagtggcgacccaagccatgacgcggtgatactt
tggacccgtgtcacccctaagcgtgatggcgagatcaaggtgtcgtgggaggtggcgacc
gatgctgcatttacccagttagtgagtaatggcgagaccatgacaagcggtgatagagac
tatacggttaaggttgatgccacagggcttgaggcgggtcgccagtatttttaccgcttc
aagacgggtaataaaacctcgcagccggcaatgactaaaaccttgccacagggcgccatc
gatagcgctaagtttgccgtggtgtcatgcgctaacttccctgcaggatattttaatgtc
tacgagatggcatcaagaatggacgatctcgatgcggtcatccacttaggcgattacatc
tatgagtatgcacggggtgagtacgccagcgagcgcgccgaagagcttgggcgtgaagtc
ttgcccgaaggtgagttgatgagtctatctgattatcgtacccgttacggtcaatatcgc
agtgatatcagtttgcagaagttgcacggtaaaacgccatttattaccgtatgggatgat
catgaagtggccaatgacagttggcgtgatggcgctgagaatcacaacgagggtgaaggg
gatttcgatgcccgcaaagaggccgcgttgcaggcttacttcgaatggctgcctatccga
ccatggagagaaggcaatcatgaagagatctatcgctcgttcaattttggtgacttagtt
gacctgcatatgcttgatacacgactcctaggccgagataagccactggattacgccgag
tatatggatcctgctacggggggcttagatagcgcacgctttatggcggacattaccgac
accaacagaaccatgcttgggcaagatcaacaagcttggctgcaaacggcgttactgact
tcgacggcgacttggcaggtattggggcagcaggtattgatggggcagatgatgctacct
gcagccattgcgactcaacaactgtcgatccctgagtttggccagttggcggcgttagca
caatttgctgcccgaaaagcggcgggcgacccaacgctgaccgcagatgagcttaagtac
ctatctttctacgggcataagttgacgcctgaggcgatggctctgctgcagttgccttct
attccttacaacctcgactcctgggatggttacgcctacgagcgagaggtgattctagcg
acggcaaaatcacagacaaaaaatctagtggtgattgcaggagacacccataatgcttgg
gctaatgaactaaaagacgccgccggtgacgctgtgggagtcgagtttgcgactagctcg
gtatcatcaccggggcttgagtattacttaggcatagaagagaaagatattgccgcaacc
gaggcggcgattgtcgatttagtcgataaccttgcctataccaacttgatgaatcgagga
ttgatgacgctcaccttcactcacgaagaggttcgtactgactggcgttacgtcgataca
atttattctcgtgactttacagaagatagcgagagaaacttctcaatggttaccaaagcg
ggcagtcatgggcttatagcggcaagttag

DBGET integrated database retrieval system