KEGG   Shewanella pealeana: Spea_0966Help
Entry
Spea_0966         CDS       T00606                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
spl  Shewanella pealeana
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1177265..1177756
Genome map
AA seq 163 aa AA seqDB search
MATIFISLGSNIDPERHLKAALTDLQDHFGPLELSSVFESEAVGFEGTNFLNMVVAAQTQ
LSIADVVSRFKQIEQRHGRVKGAKKFAPRTLDLDLLLYDDTISEQPIELPRAEILYNAFV
LWPLAEIAPTLNHPVVNQSYQALWNDYDKSQQSLWPVEFSWSA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatctttataagcttgggtagcaatatcgaccctgagcgccatcttaaggct
gctttaacggaccttcaggaccattttgggccgcttgaattgtcatctgtgtttgaaagt
gaagcggtgggctttgaagggactaactttcttaatatggtggttgcggcacaaacccag
ttatcgatagctgatgttgtgagtcgatttaaacagattgagcagcgtcatggccgagtt
aaaggtgctaagaaatttgccccaagaaccttagatttagatctattgctgtatgacgat
accattagtgagcagcctattgagttgccgagagccgagatcttgtataatgccttcgtt
ttatggccattagcggaaattgcccccactttgaaccaccctgttgtcaatcaatcgtat
caagccctttggaatgattacgataagagtcaacaatcactatggcctgttgagtttagc
tggtcagcgtaa

DBGET integrated database retrieval system