KEGG   Shewanella pealeana: Spea_0975Help
Entry
Spea_0975         CDS       T00606                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
spl  Shewanella pealeana
Pathway
spl00240  Pyrimidine metabolism
spl00250  Alanine, aspartate and glutamate metabolism
spl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Spea_0975
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spea_0975
Enzymes [BR:spl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Spea_0975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABV86302
JGI: Spea0975
UniProt: A8H165
Position
complement(1186922..1187941)
Genome map
AA seq 339 aa AA seqDB search
MTQFQGSHILSVNQLDLEAVEKVFSVATRMTPYALRQKRTTVLDGAVLGNLFFEPSTRTR
VSFASAFNLLGGRVNETVGMASSSLSKGESLYDTARVLSSYSDVIAMRHPDSFSVSEFAK
GSRVPVINGGDGSNEHPTQALLDLFTIQKELAAGGRDISGMNIAMVGDLKFGRTVHSLSR
LLCMYKDVSFTLVSPKELAMPDSVINDIANAGHKITITDQLEGNLDRADILYLTRIQEER
FPSQEEANKYRGKFRLNQSIYTQHCKSNTVIMHPLPRDSREQANELDNDLNDHPNLAIFR
QADNGLLIRMALFALTLGVDSQLEQYERPVNWYSRKADV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtttcaaggttcgcacatcctttcggtaaaccaactagacttggaagccgtt
gaaaaagttttttctgttgctactcgcatgactccctatgctttacgacaaaaacgtacc
actgtgttagatggtgccgttttgggcaatctgtttttcgaaccaagtacccgtacacgt
gtcagctttgctagcgcctttaacctactcggcggtagagttaacgaaaccgtgggtatg
gcgtcttcgtcattgtctaagggcgaatcgctatacgataccgctcgcgttttatctagt
tactcagatgtgattgccatgcgtcacccagattctttctctgtgagtgaatttgctaaa
ggcagccgcgtaccggtaattaacggcggtgatggttcaaacgagcaccctactcaagcg
ctactggatttatttaccattcaaaaagagctagcggctggcggccgtgatatcagtggt
atgaatatcgccatggtcggcgatttgaaatttggccgcaccgtacactcgctttcgcgt
ctgctatgcatgtataaagatgtcagcttcacactcgtatcaccaaaagagctagcaatg
cctgactctgtgatcaatgacattgcaaatgctggccataagatcacaataacagatcaa
cttgaaggcaatttagatcgcgcagatatactctacctgacgcgtattcaagaagaacgc
ttcccttctcaagaagaagcgaacaaataccgcggcaagttccgtttaaaccaaagtatt
tatacacagcattgcaaatcaaacactgtgatcatgcatccattgccacgagactcacgt
gagcaagcaaatgaattggataacgatcttaacgaccatccaaatctggctatctttaga
caagccgataatggtctgttgatccgcatggcgctgtttgcactgacgttaggtgttgac
tctcagcttgagcaatacgaacgtccagttaattggtattcacgaaaagctgatgtgtaa

DBGET integrated database retrieval system