KEGG   Shewanella pealeana: Spea_1068Help
Entry
Spea_1068         CDS       T00606                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
spl  Shewanella pealeana
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spea_1068
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spea_1068
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spea_1068
Enzymes [BR:spl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spea_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1292605..1293891
Genome map
AA seq 428 aa AA seqDB search
MELYNLKHPSQVVSFTQAVKLGLGKDRGLFFPKVIPELQDVESLLALPFVERSKKVIGAW
LASELGQDTVDRLVERAFNFELPLVKADSNLYSLELFHGPTLAFKDFGARFMAQCLNELA
KTEKINILTATSGDTGAAVADAFYGLDNINVVVLYPRGKISVLQEKMFTTLGENIHTVAV
ESDFDACQSLVKQSFEDLDIRDGLHLNSANSINISRLLAQICYYFEAVAQFKQHNESEPV
IAVPSGNFGNLTAGLFAKAMGLPVKRFVAATNSNDTVPRYLGSGDWQPEATVATISNAMD
VAEPSNWPRVEAIVEAMGWSLADIIGLGVSETDTAESVKALNSAGYLSEPHAAIAALALK
QTMSADEKGIFLATAHPAKFNEVVEDILKIELTLPEPLARVVPKQILSAELPADFGLLKQ
HLFKLLAD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtataacctaaaacacccatcacaggtggtgagttttacccaagcggtcaag
ctaggccttggaaaagacagaggcttatttttcccgaaagtcatcccagagttgcaagat
gtggaaagcttattggcattgccatttgttgaaagaagtaaaaaagtcatcggtgcttgg
ttagcatcggagcttggccaagataccgtcgatagattagtggaacgtgcctttaacttc
gagcttcctttagtgaaagccgatagcaatctctatagtcttgagctatttcacgggcca
acccttgcctttaaggattttggcgcacgctttatggcgcagtgtttaaatgagttggca
aagacggagaagattaacatcttgaccgctacctctggtgataccggggcggcggtggct
gatgccttctatggcttagacaatatcaatgtggttgtcttataccctagggggaagatc
agtgtgctccaggaaaagatgttcaccacgttaggggagaatattcacacggtagcggta
gagtctgattttgatgcgtgccaaagcttagtgaagcaatcttttgaagatctggatatt
cgagatggcttgcaccttaactctgcaaactcaatcaacattagccgcctattggctcag
atctgttactacttcgaggcagttgctcaatttaaacaacacaatgaaagtgagcctgtc
attgcagttcctagtggcaatttcggcaacctaacggcgggtctatttgctaaggcgatg
ggactaccagtaaaacgttttgtggctgcaacaaacagtaatgatactgtgcctcgctat
ctaggcagcggtgactggcaacctgaagcaacagtcgccaccatatctaatgctatggat
gtagctgagccgagcaattggccacgtgtagaggcaattgtagaggcgatgggctggtca
ttggcagatatcataggtttaggcgtctctgagactgatactgctgagtcggtaaaagcc
ttgaacagtgccggatatttgtctgagccccatgctgcgattgcggcattggcactaaaa
caaaccatgtctgcagatgagaaaggtatcttcttggcaacggcgcaccctgcaaagttt
aatgaggtggtggaagatattcttaaaatagagcttactctgccagaacctttagcccga
gttgtgccaaagcaaattttatcggctgagttaccagcagattttggtttactaaaacaa
catctttttaagttgttagccgactaa

DBGET integrated database retrieval system