KEGG   Shewanella pealeana: Spea_1076Help
Entry
Spea_1076         CDS       T00606                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
spl  Shewanella pealeana
Pathway
spl00030  Pentose phosphate pathway
spl01100  Metabolic pathways
spl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Spea_1076
Enzymes [BR:spl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Spea_1076
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Spea_1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP XFP_C TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABV86403
JGI: Spea1076
UniProt: A8H1G6
Position
complement(1301193..1303559)
Genome map
AA seq 788 aa AA seqDB search
MAHQQEIVALKKFVRATNFLATSQIYLKKNVLHKRALEHSDIKPRLLGHWGTCPGINFVY
ANVNRLISKHKRSFVYLVGPGHGFPAVQANLFMEGSLSHFYPDTIPYNEDGITDICQKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVAWGAVLDNPDLIAACLIGDGESETGPLAASW
YANRLVSPKNNGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYQPIIVDDQLEED
VYLQMAAAMDKSYEMINDIQTRARAGEDIVKPRWPVILMRTAKGWTGTAEFNGKKLEGNC
ESHQVIVNKCASDKGHLDALNTWLASYKFSELYSISDKGELIFDQDIQSLLPPKELSCGR
QHLSYGGEVVRALAQPDLEKLAYGPETPRGHRGLSMYKMGEWMRDAFKLNRDQRNLRIFC
PDETYSNQLQAVFEETSRAWQWPIESWDEDMSRDGRVIELLSENLLFGMLHGYTVTGRHA
MFPTYEAFSQVVSSMADQYCKYVYASQGVHFRKPVPACNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADGNSTLVYTERAYADRDKLNILVAGKKDLPQWLTLNEARQQ
AKDGVMVWDFASDESPDVVLVGCGDYVTQEAMASLVLIRELLPRVRIRFVSVTELTSSGL
GSLEFQSKPWLMDEIFTTDKGVVFNYHGYPNTIKKLVFDYKGSKRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQSVIDETQHVAITTDMLQRLVDHRNYIKANGVDPES
IENWVWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcagcaagaaattgtcgcactaaagaaatttgttcgagcaactaactttcta
gcgacatcacaaatttacttaaagaaaaacgtgctgcataaacgcgcactcgaacatagc
gatatcaagccaaggctactcggccactggggaacctgtccggggatcaactttgtttat
gctaacgtcaacagacttatcagcaaacacaaacgctccttcgtttacttggtcggtcct
ggtcacggcttcccagccgttcaagcaaacttatttatggaaggctccttaagccatttc
tacccagacaccattccatataacgaagacggtattaccgatatttgccagaaattctca
gcagcctatggctacccttcccatgcaaaccctgaagcgccaggccaaatcctagaaggc
ggcgaattaggctattcactgtctgttgcttggggcgccgtgttagataatccagatctg
attgcagcgtgtctaattggtgatggggaatctgaaactgggccactagccgcatcttgg
tacgctaaccgccttgtttcaccaaagaacaatggtgctgtgctgcctatcgttcatatt
aacggctacaagatctctggcccaactcgtatggggcgtatgagccatgaagagctcgac
cttgagtttagaggcttaggctatcagccaatcattgttgatgaccagctagaagaagac
gtttaccttcaaatggctgcggcaatggataagtcatatgaaatgatcaatgacatccag
acccgagctcgcgctggcgaagacattgtaaagccgcgctggccagtgatcttgatgcgt
acggcaaaaggctggacgggtacagctgagtttaatggtaagaagttagagggtaactgc
gaatcccaccaagttatcgttaataagtgtgctagcgacaaggggcatctagatgccctc
aatacatggctagccagctacaagttcagcgagttatatagcatcagcgacaaaggcgag
cttatcttcgaccaagacattcagtctctgctaccgcctaaagaactgtcttgtggtcga
caacatttaagctacggcggtgaagtggttcgagcattggcacaacccgatcttgaaaag
cttgcctacggcccggaaactccacgcggtcatcgcggcttatctatgtataagatgggt
gaatggatgcgtgatgcctttaagctcaatcgcgaccaacgcaatctacgtattttctgc
ccggatgaaacctattcaaaccagctacaagcagtgtttgaagaaacgagtcgtgcatgg
cagtggcctatagaaagctgggatgaagacatgtcccgtgatggccgagtcattgagcta
ctttcagaaaacctattgttcggtatgctacatggttataccgtaacgggtcgccatgcg
atgttcccaacttatgaggctttctcgcaggttgtatcatcgatggcagatcaatactgt
aaatacgtatacgcaagccaaggtgtgcacttccgtaagcctgtacctgcttgtaacgta
gtattgtcatcactacttgagcgtcaagatcacaatggttactcacatcaaaatccatct
ttcctaggtgctatgctcgagaaacatcctaagatcatttcggcttatctacccgcagat
ggtaacagtacactggtttacaccgaacgcgcctatgccgatcgagacaagttaaacatc
ttagttgcaggtaagaaagatctgccacaatggctcacgctcaatgaagcccgccaacaa
gctaaagacggtgtcatggtttgggactttgcctcagatgaaagtcctgatgtagttctt
gttggttgtggggactacgtcacccaagaagcaatggcctcactggtacttatccgcgag
ctcttaccacgtgtacgtattcgtttcgtgagtgttaccgagcttacaagtagtggccta
ggtagcttagagttccaaagtaagccttggttgatggatgaaatatttaccaccgataaa
ggcgtggtatttaactatcacggttatccaaacaccattaagaaactggtatttgactat
aaaggcagtaagcgtttcagaatcaaaggctatgaagaggaaggttcaactacaacacca
tttgatatgggcgtgcgtaacggtacttcacgttaccacttggttatagacatggcgtat
aaactattccagcaaagcgttattgatgaaacccagcatgtagcaatcaccactgatatg
ctgcagcgcttagtcgaccacaggaattatatcaaggctaacggggttgacccagaaagc
attgaaaactgggtttggactcggtaa

DBGET integrated database retrieval system