KEGG   Shewanella pealeana: Spea_1111Help
Entry
Spea_1111         CDS       T00606                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
spl  Shewanella pealeana
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spea_1111
   00330 Arginine and proline metabolism
    Spea_1111
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Spea_1111
Enzymes [BR:spl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Spea_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1345820..1346734
Genome map
AA seq 304 aa AA seqDB search
MPELALLEEVIEKVRPLLGQGKVADYIPALAQVDANKLGIAVTTSDGVTIGAGDYLEPFS
IQSISKVFSLTLALMLYEEDEIWSRVGKEPSGHSFNSLVQVELEKGLPRNPFINAGALVI
ADLLQSRLGAPKHRMLEIVRQLSENHRIGYDKVVAASEYQHSARNAAIAYLMKSFGNFNN
DVDTVLHSYFHYCSLRMSCADLSRAMFYLANSGKSLAGKQLITPVQNRQLNALLATSGLY
DGAGEFAYRVGMPGKSGVGGGIIAVIPGDMSVCVWSPELDANGNSLAGTAVLEALSQTLG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattggcattacttgaagaggtcatcgaaaaagttcggcctcttctaggacag
gggaaagtagctgattatattccagcgcttgcccaagtcgatgctaataagctaggtatt
gcggtgacaacctctgacggtgtcacaataggggctggagattatctcgagcccttttca
attcagagtatctctaaggtatttagtcttaccttagcgctgatgttgtatgaagaagat
gaaatttggtcgagagtaggtaaagaaccctcaggccattcttttaactctttagtacag
gttgaattggaaaaaggcttacctcgaaatccatttatcaacgctggcgcgctggtcatt
gccgaccttttgcaaagtcgcctaggtgctcctaagcaccgtatgcttgagattgttcgt
cagctcagtgaaaaccatcgcataggttacgataaagtcgttgccgcgtctgagtatcaa
cacagtgcaagaaatgctgcgattgcttacttgatgaagtcctttggtaatttcaacaat
gatgtcgatactgtgctgcatagctattttcattattgttcgctgcgcatgagctgcgca
gatctatcccgtgctatgttttacttagcaaactcaggtaagagccttgctggtaagcaa
cttattacgcctgtgcaaaatcggcagctaaatgccttattagccacatctggtctttat
gatggtgctggtgagttcgcttatcgtgtcggtatgccgggtaagagcggtgtcggtggt
ggaattatcgcggtgatccctggcgatatgtctgtgtgcgtttggtccccagagcttgat
gccaacggcaactctttagcgggcactgctgtgttagaggctttgagtcagactttaggt
cgctcaattttctag

DBGET integrated database retrieval system