KEGG   Shewanella pealeana: Spea_1191Help
Entry
Spea_1191         CDS       T00606                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
spl  Shewanella pealeana
Brite
Enzymes [BR:spl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Spea_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 CmcI DUF938 MTS RrnaAD Methyltransf_4 Methyltransf_11 NodS
Motif
Other DBs
NCBI-ProteinID: ABV86518
JGI: Spea1191
UniProt: A8H1T1
Position
1445346..1445981
Genome map
AA seq 211 aa AA seqDB search
MNPVASTSALNLARSLYEAGIRNEAVLRAVANTPREQFLEPALGHKAYENTALPIGQGQT
ISQPYIVARMTEIILQNKPSKVLEIGTGSGYQAAVLAQLVPQLCTVERIKSLQIQARQRL
KKLDLHNVAFKYGDGWQGWPSKGPYDAIMVTAAASSVPEALVAQLADGGVLVIPVGELSQ
QLLKLTRVGNQFTSEVIENVRFVPLVSGELA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctgtcgcctcaacatcagcattgaaccttgcaagaagtctgtatgaggctggg
atccgtaatgaagctgtattgcgtgcggtcgcaaatactccgagggagcagtttcttgaa
cctgcacttggtcataaagcttatgagaatactgcgctgccgatagggcaaggtcagact
atttctcagccttatatcgttgccagaatgactgaaattatcttgcagaataagccaagt
aaagtgcttgagataggtacgggatcaggctatcaagctgcggttttagcacagctagtt
ccacaactttgcacggtggaacgaattaaaagtttacagatccaggccagacagaggctt
aaaaagctcgatttacataatgtcgctttcaaatatggcgatggttggcaaggatggcca
agtaaaggcccttacgacgcgattatggtgactgcagctgcaagttcagttcctgaagcc
ttagtggcgcaattagctgacggtggtgtattagtcattcctgttggcgagttatcgcaa
cagctgttgaagcttacccgagttggcaatcagtttacctccgaggtgattgagaatgtg
cgctttgtgccgctagtgagtggcgagctggcatag

DBGET integrated database retrieval system