KEGG   Shewanella pealeana: Spea_1290Help
Entry
Spea_1290         CDS       T00606                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
spl  Shewanella pealeana
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spea_1290
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spea_1290
   00630 Glyoxylate and dicarboxylate metabolism
    Spea_1290
Enzymes [BR:spl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Spea_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1573642..1575306
Genome map
AA seq 554 aa AA seqDB search
MSKVLGDKMMTEQLTALDTCDALVSSQELQIKGQAVAGQEQVLTEGTLCLLKALCKQFAP
QVPDLLANRQAKQKRIDLGELPDFLEETKEIRQGNWQIRGIPEDLQDRRVEITGPVERKM
VINALNANAKVFMADFEDSLAPSWHKVVQGQINLRDAVNGDIGYTAPETGKHYSLNDNPA
VLICRVRGLHMQEQHVQFGGVAIPAGLFDFCVYFYNNYCKLLSKGSGPYFYIPKLESHLE
AKWWARVFAFVEARFCLQPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIF
SYIKTLNNHSDRVLPDRQSVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDTEL
NQQVLAKVKQDKQLEARNGHDGTWVAHPGLADTAMAIFNEYIGEDHINQLHITRDVDAPI
HARELLEPAKGQCTEAGMRLNIRIALQYIESWINGNGCVPIYGLMEDAATAEISRTSIWQ
WIKHRQQLTSGAVVTKALFKDMLVEELAHVKDEVGADRFTHGSFTQAAVLLEQITTADEL
VDFLTEPGYQLLVE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagttttgggagataaaatgatgacagagcaattaacagcgctagatacttgc
gacgcactggtatcgagtcaagagttacagataaaagggcaagctgttgcagggcaggag
caggtattaactgaaggcacactgtgcttgttaaaggcattgtgtaagcagtttgcgcca
caggtgccagatttacttgctaataggcaggcaaagcaaaagcgtattgatttaggtgag
ttgcccgattttttggaggagaccaaggagatccgtcaagggaattggcagatccgaggt
attcctgaagacttacaagataggcgcgtagagatcaccgggcctgttgagcgcaagatg
gtgatcaatgcgcttaatgctaatgccaaagtgtttatggccgattttgaggattcactg
gcgccaagctggcacaaggtggtgcaaggtcaaatcaacctgcgggatgcggtgaacggt
gatattggctatacggcgccagaaacaggcaagcattattcattaaatgacaatcctgcg
gtgcttatttgccgagtccgtggtctacatatgcaagagcagcatgtgcagtttggcggc
gtcgccattcctgctggcttgttcgatttttgtgtctatttctacaataactactgtaag
ttattgagtaagggcagcgggccgtatttttatattcctaagctagaaagccatctagag
gccaagtggtgggcaagagtgtttgcttttgttgaggcgcgtttctgtttacagcctggc
accataaaatgtacctgcctaattgaaaccctacccgccgtctttgagatggatgagatc
ttgtatgaactgcgctctaacatcgttgcgcttaattgcggtcgttgggactatatattt
agctatattaaaaccctaaataaccatagcgacagagtgctgcccgacaggcagtcggtc
accatggataagccatttttaagtgcttactctcgcttattgatcaagacctgccacaag
cgtggtgcgttagctatgggcggcatggcagcctttattccagcaaaagatactgagctc
aatcaacaagtgctagctaaggttaaacaggataagcaactcgaagcgcgaaatggccat
gatggcacttgggtagcacatcctgggctggccgatactgcgatggcaatttttaatgaa
tacataggtgaagaccatattaatcaactacacattacccgtgatgttgacgcccctatt
catgctagagagttactcgaacctgcaaaggggcaatgtacagaagctggcatgcgcctc
aatattagaattgcactgcaatacatagagtcgtggattaacggcaatggctgcgtgcct
atctatggcttaatggaggatgcggctacggctgaaatatctcgcacttcaatttggcag
tggattaagcatcgtcagcagcttacctctggggctgtggtcactaaggcactatttaag
gatatgttggtagaagagctcgcccacgttaaagatgaggtaggggccgatcgttttact
cacggcagttttactcaggccgcagtcttgctagagcagatcactacagcagacgagttg
gtcgattttttaactgagccgggatatcaactgttggtggagtaa

DBGET integrated database retrieval system