KEGG   Shewanella pealeana: Spea_1290Help
Entry
Spea_1290         CDS       T00606                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
spl  Shewanella pealeana
Pathway
spl00620  Pyruvate metabolism
spl00630  Glyoxylate and dicarboxylate metabolism
spl01100  Metabolic pathways
spl01110  Biosynthesis of secondary metabolites
spl01120  Microbial metabolism in diverse environments
spl01200  Carbon metabolism
Module
spl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spea_1290
   00630 Glyoxylate and dicarboxylate metabolism
    Spea_1290
Enzymes [BR:spl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Spea_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABV86617
JGI: Spea1290
UniProt: A8H230
Position
1573642..1575306
Genome map
AA seq 554 aa AA seqDB search
MSKVLGDKMMTEQLTALDTCDALVSSQELQIKGQAVAGQEQVLTEGTLCLLKALCKQFAP
QVPDLLANRQAKQKRIDLGELPDFLEETKEIRQGNWQIRGIPEDLQDRRVEITGPVERKM
VINALNANAKVFMADFEDSLAPSWHKVVQGQINLRDAVNGDIGYTAPETGKHYSLNDNPA
VLICRVRGLHMQEQHVQFGGVAIPAGLFDFCVYFYNNYCKLLSKGSGPYFYIPKLESHLE
AKWWARVFAFVEARFCLQPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIF
SYIKTLNNHSDRVLPDRQSVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDTEL
NQQVLAKVKQDKQLEARNGHDGTWVAHPGLADTAMAIFNEYIGEDHINQLHITRDVDAPI
HARELLEPAKGQCTEAGMRLNIRIALQYIESWINGNGCVPIYGLMEDAATAEISRTSIWQ
WIKHRQQLTSGAVVTKALFKDMLVEELAHVKDEVGADRFTHGSFTQAAVLLEQITTADEL
VDFLTEPGYQLLVE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagttttgggagataaaatgatgacagagcaattaacagcgctagatacttgc
gacgcactggtatcgagtcaagagttacagataaaagggcaagctgttgcagggcaggag
caggtattaactgaaggcacactgtgcttgttaaaggcattgtgtaagcagtttgcgcca
caggtgccagatttacttgctaataggcaggcaaagcaaaagcgtattgatttaggtgag
ttgcccgattttttggaggagaccaaggagatccgtcaagggaattggcagatccgaggt
attcctgaagacttacaagataggcgcgtagagatcaccgggcctgttgagcgcaagatg
gtgatcaatgcgcttaatgctaatgccaaagtgtttatggccgattttgaggattcactg
gcgccaagctggcacaaggtggtgcaaggtcaaatcaacctgcgggatgcggtgaacggt
gatattggctatacggcgccagaaacaggcaagcattattcattaaatgacaatcctgcg
gtgcttatttgccgagtccgtggtctacatatgcaagagcagcatgtgcagtttggcggc
gtcgccattcctgctggcttgttcgatttttgtgtctatttctacaataactactgtaag
ttattgagtaagggcagcgggccgtatttttatattcctaagctagaaagccatctagag
gccaagtggtgggcaagagtgtttgcttttgttgaggcgcgtttctgtttacagcctggc
accataaaatgtacctgcctaattgaaaccctacccgccgtctttgagatggatgagatc
ttgtatgaactgcgctctaacatcgttgcgcttaattgcggtcgttgggactatatattt
agctatattaaaaccctaaataaccatagcgacagagtgctgcccgacaggcagtcggtc
accatggataagccatttttaagtgcttactctcgcttattgatcaagacctgccacaag
cgtggtgcgttagctatgggcggcatggcagcctttattccagcaaaagatactgagctc
aatcaacaagtgctagctaaggttaaacaggataagcaactcgaagcgcgaaatggccat
gatggcacttgggtagcacatcctgggctggccgatactgcgatggcaatttttaatgaa
tacataggtgaagaccatattaatcaactacacattacccgtgatgttgacgcccctatt
catgctagagagttactcgaacctgcaaaggggcaatgtacagaagctggcatgcgcctc
aatattagaattgcactgcaatacatagagtcgtggattaacggcaatggctgcgtgcct
atctatggcttaatggaggatgcggctacggctgaaatatctcgcacttcaatttggcag
tggattaagcatcgtcagcagcttacctctggggctgtggtcactaaggcactatttaag
gatatgttggtagaagagctcgcccacgttaaagatgaggtaggggccgatcgttttact
cacggcagttttactcaggccgcagtcttgctagagcagatcactacagcagacgagttg
gtcgattttttaactgagccgggatatcaactgttggtggagtaa

DBGET integrated database retrieval system